Repbase Reports

2005, Volume 5, Issue 2
February 28, 2005
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 46

hAT-2_AG

hAT-2_AG is a hAT-like autonomous DNA transposon - a consensus sequence.

Submitted:
00-Feb-2005
Accepted:
28-Feb-2005
Key Words:
Autonomous DNA transposon; hAT superfamily; 8-bp TSD; transposase; hAT-2N_AG; hAT-2_AG
Source:
Anopheles gambiae
Organism:
Anopheles gambiae
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
hAT-2_AG: a family of autonomous hAT DNA transposons from African malaria mosquito.
Journal:
Repbase Reports 5:(2) p.46 (2005)
Abstract:
hAT-2_AG is a young family of autonomous DNA transposons that belongs to the hAT superfamily. hAT-2_AG elements are less than 1% divergent from the consensus sequence. The genome harbors 3 copies of hAT-2_AG; only one copy is intact-like. hAT-2_AG has imperfect 17-bp terminal inverted repeats (3 mismatches). hAT-2_AG encodes the 603-aa hAT-2_AGp transposase (pos. 2688-595). The N-terminus of hAT-2_AGp contains the BED zinc finger. hAT-2_AGp: MASNVATSSSIWDHFTRNGTKAKCRYCYNEIAFTKGSTSNLKRHMKAKHPSISLERQHLASTTS PSTQNSEPGPSCSSRPPNLISNFFKQPMNSETKRKLDMMLLKLICKDCLPLSIVESEAFKTFVG CLNQNYDLPTRKNVSNALLPSIYNEILVKVQGEVRNATSIALTTDGWTNVNNTSFLGLTAHFID NDYKLRSCLLECSEISLSHSGQNIAAWIKEVIIKYEIQDKIVGIVTDNAANMKSAARELEFNHV TCFAHSLHLIVKDAIKKSIISTVDEVKRIVMYFKKSPKATNELADTQSKFNLPNLKLKQDVPTR WNSTYDMLNRFYKNKIAIVACADKLNTLDPIKIDWAILEHSLNALKIFDVATNMVSAEKNITVS HVGLLSKMIIRKLNETDYTIPELGNLVTHLKEGVKKRLEIYSNNQIIAKSMLLDPRIKKQGFHE EPLKYRETYELIIQELIPFQTPSMNAQEPHNIDNEANLLLGEFITWVNNAECEIESPIELAKNE LNSFLKIRNIDIKNDPLEWWRIHSSKYPSIYALAKTIICIPGTSVPCERLFSKAGQIYSDKRSR LHPKKFKEIIFIQQNVDKF
Derived:
[1] (consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute