Repbase Reports

2005, Volume 5, Issue 1
January 31, 2005
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 23

Gypsy-25-I_DR

An internal portion of the Gypsy-25_DR LTR retrotransposon - a consensus sequence.

Submitted:
00-Jan-2005
Accepted:
31-Jan-2005
Key Words:
LTR retrotransposon; endogenous retrovirus; Gypsy superfamily; gag; reverse transcriptase; integrase; Gypsy-25_DR; Gypsy-25-LTR_DR; Gypsy-25-I_DR
Source:
Danio rerio
Organism:
Danio rerio
Taxonomy:
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Cyprinidae; Danio
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Gypsy-25_DR, a family of LTR retrotransposons from zebrafish
Journal:
Repbase Reports 5:(1) p.23 (2005)
Abstract:
Gypsy-25-I_DR is an internal portion of the Gypsy-25_DR LTR retrotransposon that belongs to the Gypsy superfamily. Its long terminal repeat is deposited in Repbase as Gypsy-25-LTR_DR. Gypsy-25_DR is characterized by 4-bp target site duplications. The internal portion encodes one polyprotein: the 1503-aa Gypsy-25_DR1p (pos. 64-4572) composed of the gag, protease, reverse transcriptase, and integrase domains. The consensus sequence was built from 3 copies less than 0.5% diverged from the consensus sequence. Gypsy-25_DR1p: MDTAYTTVDEVEITEPQINPVIHTVDLSEGNETDYTGEQFTTRRNPTEQLTSLLSSLYISDHDQ TADVVSDEVGNQGIHDEVFQLKEDLLALSDKVQNMEHDFNQAFESTVNRETNFRQALDDRLNSM QENFEDSLKKLEKAVIDCFLRRDEKWESKIKQIYSTSTPFPSRRQTRQTNVTHSDLFSAAQSPI TQPSFNATYHVSAPSSSGHQTQSDANVLPGSSSFFARPPVRLEFPSFGETCETADVFNFIEKCE DYLEVRPLSNIELLGTLSTVLQGPALSWWKAEKGKVKDWESFKRALMDAFLPADYMSEVEEKLR NMVQQPNQRLRDFAYNYRALCLKWKPDASEEELVNRILNNINPRVAGCLRGTVNTVSQLVKVGA LVEKDCMGTKEYWKKVESSNERDKNKKSSEAGSRKHLAGVTLTQHHPTSFLLGVTIKVNEQEIT AILDTGSTFTLIQESVWKRLRCKRVEASKTLSSQKFIMADGTIHHSKDHQLMSVEWHGGKFEIG AFIMKDSHLAFPVIIGLDFLKLARVVVDLEQGRYGMRRGKDCEYFPFMSVLPPCSQEMPVSPSC SVRHAALHLYCAVPPDYQPKVTYPSDTSNICFPEEVRDLITAWPITTSEKLGHTSIYQHKITLT DHTPVTSRAYRVSPLKKRIIEEEVDRMLENNIIEPSFSPWSSPVVLVPKEDGTYRFCVDYRRLN KKTIFDAYPMPLIQDILESLEGATWFTSLDLRSGYWQVEMAEESKELTAFITTKGLFHFKSMPY GLKNSAATFQRLMERVLGELRGKICFVYIDDIIIYSKTPEEHKKHLHQVFERLTQANLTLNMKK CQFFTRQLKFLGHLITERGIEMDKEKIQAVVDFPTPSDLKSLQRFLGLAGWYHRYIPHFADITA PLNQLKKKGVRWDWTEECQSSVNALKQSLQHAPILAQPDTTKPFQIHTDASDVGLGAVLTQTCD NQEKVIAYASRTLSPAEKNYSTSEKECLAVVWAVEKWRHYLEGMPFDVFTDHSALTWAFNCPKT SSRLTRWTLRLQQFDFRVHHRKGCVNLVPDALSRAGDSSVPNPCLSITSTTASELPISLDEIQK AQQDDKALLQLTSTPSRCVAKDQAITFEKIQGIWYRKVPLKGEGNKYQLVVPEEFTQNFLHYFH DNPLAGHLGQLKTLLKILEVAWWPSVRKEVWSYVKSCKLCQQYKPSNSKPSGLLQSNLITEPGH TLGTDLMGPFPMSKKRNAYILVIVDYFTKWTELFPLRDSKTQKIAKILKEEIFTRWGVPKYLVS DRGPQFTSSILSDVCKSWGCIQKLTTAYHPQSNLTERVNRTLKTMIASYVGQQHQNWDQWLPEL RYAINTAQQETTGCTPAELMVGRQIHGPLERLIHLPPSPEQASYTVLDRQHYLQQEVVQRMRMN QAKQAKYYNLKRKDVQFKVGDLVWLKTHPLSSAVSKFTSKLAPKWEGPGVITKRKGPINYSVSW GDPPRTDCFNVVNLKRFYGRSSSEMPAGGGI
Derived:
[1] (consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute