Repbase Reports

2005, Volume 5, Issue 1
January 31, 2005
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 7

Gypsy-17-I_DR

An internal portion of the Gypsy-17_DR LTR retrotransposon - a consensus sequence.

Submitted:
00-Jan-2005
Accepted:
31-Jan-2005
Key Words:
LTR retrotransposon; endogenous retrovirus; Gypsy superfamily; gag; protease; reverse transcriptase; integrase; Gypsy-17_DR; Gypsy-17-LTR_DR; Gypsy-17-I_DR
Source:
Danio rerio
Organism:
Danio rerio
Taxonomy:
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Cyprinidae; Danio
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Gypsy-17_DR, a family of LTR retrotransposons from zebrafish
Journal:
Repbase Reports 5:(1) p.7 (2005)
Abstract:
Gypsy-17-I_DR is an internal portion of the Gypsy-17_DR LTR retrotransposon that belongs to the Gypsy superfamily. Its long terminal repeat is deposited in Repbase as Gypsy-17-LTR_DR. The consensus sequence was reconstructed based on multiple alignment of two proviral copies (they are less than 1% divergent from the consensus sequence). Gypsy-17_DR retrotransposons are characterized by 4-bp target-site duplications. The internal portion contains two ORFs encoding the 572-aa Gypsy-17_DR1p gag (pos. 85-1799) and 1578-aa Gypsy-17_DR2p pol proteins (pos. 1794-6527) composed of the protease, reverse transcriptase, and integrase domains. The second protein, including the protease domain, does not start from Met. Presumably, the gag-pol fusion protein is formed originally due to a ribosomal frame shift. This family is likely still active in the genome. One proviral copy is flanked by identical LTRs. Gypsy-17-I_DR1p: MEIVHAENICIRNAVIISGLTHTERDDEVLKHLSDYGSIERLIRIDEPKTEFHGQIIVEFKNDS AMQLLEQSLPTAFQSPTSSDVTYTIKSLTSVYTPAASSSATHTFIEGLREISKVTGKPLEELLQ DELAKLTASAVSPPQTESEFLTTESDPEGSQKRVVEPTQTTMVSAHGDVTPSNESVIFQTKSNN SLPQISASPSRLNADMGTPLKLTVSDVTPAEVQRLVVEHIVRSDTPSHSLTTMRLRPFSGKPSY SANEIDYDTWRTNIEFFCTDSTLTDAQRSQRILDSLLPPAADVVKHLGPHSPPSDYLELLESAF GTVEDGDELFAKFMSTFQDAGEKPSQFLHRLQKVLSTAIKRGGVSAADRDRHLLKQFCRGCWDN ALITELQLEQKRKNPPAFSDLLLLLRIEEDKQSIKAVRMNQHLGAAKHSATPPRRVVTNLHSIS AACSAVKHDEVEDLKRQVVELQNQIASMKPFKKCKEFKPKEPSVPSKSAKTFSPKPSKGTNPQP NKSAKPRPWYCFNCGEDGHIASRCETSPNPSLVGAKNRQLKEKQLQWEVCDGVPDPNDLN Gypsy-17-I_DR2p: FKLTSVPFVGQRGTGESSQSPTDNLAVSVSDDSPTPKHKCCLKLPSGLIGTKCTARVLIADKEI NCLLDTGSQVTTFPLSFYQDVFANQPIQPLHHLLEIEGANGCQVPYLGYIETSITFPKEFVSSD IEVPTLALIVPDTRPNAQVLIGTNTLNSLYSEYISSKPLKHHPVPQGYQAVMQVLEFVHRQGAE GNLGWVNLNCRVPESIPAGKTVVLEGSVRMSTPVTDRWVVVEAPRASSLPGGIMVSSCLLSLTA GGKYLPIVLKNETEHDVVLPPKIRLAEVNSIQCVMPNGQNNVLTSSVNLTKNSEDSKIHFNFDN SPLTSEWRERVTRKLNSMHEVFACHDLDFGHTTKTKHHIRLHDETPFKHKARPIHPKDIQAVRK HLQELLDAGIIRESESPFSSPIVVVRKKNGEVRLCVDYRKLNLQTIKDAYALPNLEETFSALTG SRWFSVLDLKSGYYQIEVEEIDKPKTAFVCPLGFWEFNRMPQGVTNAPSTFQRLMERCMGDINL KEVLVFIDDLIVFSATLEEHEERLLRVLHRLKDYGLKLSPEKCTFFQTSVRYLGHIVSPSGVET DPDKIKALKTWPSPTNLKELRSFLGFAGYYRRFIKDFSKIVKPLNHLTSGYPPLHKSKKTQEIK GHYLNPREPFKQRWTSNCQHAFEEIIDKLTSAPILGFANPKLPYILHTDASTTGLGAALYQEQE GKMRAIAFASRGLSFSESRYPAHKLEFLALKWAVTEKFHDYLYGSQFTVITDSNPLTYILTTAK LDAASYRWLSALSTYSFSLKYRAGKLNLDADGLSRRPHEVAMDVVSRKEQERIDKFLTLHLENL GETSLTQDEVEAICDKHIISSMPEDVVESASDRTVLVHSLAMSSNAVPNSYEEEELGVSLIPRL SVQDLIEKQGADSTISQIISHLNSGEKPSPTVRGELPELSLMMREWNRFVLLDGVLYRKRQNGE VLTHQLVLPKEFRATVLRSLHDEMGHMGIDRTLDLARSRFYWPKMAQEVEQKIKTCPRCVLHKA PPEKAAPLVNIRTTRPLELLCMDFLSLEPDRRNFKDILVITDHFTKYAVAVPTVNQKARTVAQA LWDNFIVHYGFPERLHSDQGRDFESHTIKELCSISGIKKGRTTPYHPRGNPVERFNRTLLNMLG SMNDEQKAHWRDFVKPLVHAYNCTKSEVTGFTPYELMFGRQPRLPIDLAFGLPTTSKRLSHSQY VSKLKKHLEESYQIATRNALKNAERNKIRFDKHVVDSTLEVGDRVLVKQVRLRGKHKLADKWEP SAYIVVRRVHDLPVYTVRPEGDEGPLRTLHRDLLLPCGFLTLPGEKVSNPPSSTSKPRTRQQVS GEDASENGVNDTAESMEDEVPEYWIRIPVTNESHENALGTLTSTFDPPVGCDPQLPFVALGDES HVEMDSAGLEACLDDSHQEKQIKQITTLQGESSEMSESGKSSEGELSEEMPQCPDDGIERSVEE ELEEEIRKPLSNAPDNISSNIEQHETSQEPENPMRRSQRRKEKPDRLQYSELGNPLVIVAQALF HGLTTAFTNSLNGVDFVETSSPSTSDKAVTCQPVRVNATGRA
Derived:
[1] (consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute