Repbase Reports

2005, Volume 5, Issue 1
January 31, 2005
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 3

Gypsy-15-I_DR

An internal portion of the Gypsy-15_DR LTR retrotransposon - a consensus sequence.

Submitted:
00-Jan-2005
Accepted:
31-Jan-2005
Key Words:
LTR retrotransposon; endogenous retrovirus; Gypsy superfamily; gag; reverse transcriptase; integrase; Gypsy-15_DR; Gypsy-15-LTR_DR; Gypsy-15-I_DR
Source:
Danio rerio
Organism:
Danio rerio
Taxonomy:
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Cyprinidae; Danio
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Gypsy-15_DR, a family of LTR retrotransposons from zebrafish
Journal:
Repbase Reports 5:(1) p.3 (2005)
Abstract:
Gypsy-15-I_DR is an internal portion of the Gypsy-15_DR LTR retrotransposon that belongs to the Gypsy superfamily. Its long terminal repeat is deposited in Repbase as Gypsy-15-LTR_DR. Gypsy-15_DR is characterized by 4-bp target site duplications. The internal portion encodes two proteins: the 628-aa gag Gypsy-15_DR1p (pos. 112-1995) and 1554-aa Gypsy-15_DR2p polyprotein (pos. 2022-6683) composed of the protease, reverse transcriptase, and integrase domains. PBS is complementary to Arg-tRNA. The internal portion is flanked by 99% identical LTRs. Gypsy-15_DR1p: MDVVRRENITVANSLIVSGLTLTELDNELEAYLLRYGSIRRNVIIDDPASDFHKLLIVEFNENS AFQTLHPHLPLTLGSLSDPSITFRVRALAAVCDPPVVSTATEGYLEQLKAIAKESGRPFQTVLQ EELEKLKETHSVDQTLAESQKIEVADTQSRDNTLISESPNVAEIDPQDSESKNPTKNRIIYVSP PLPETTADDNLTTVFPSSSTNIMGDPQVQRMVVEHVVKTSDAMMSQQTSIRLRVFSGKSPRPPN EPDYDTWRASVDYLLNDPSISDLHRTRKILDSLLPPAADVVKHVRPPALPAVYLELLESVYGSV EDGDELLAKLMGTFQNQNEKSSDYLHRLQVLLSAVIRRGGIKESERDRYLLKQFCRGCWDSRLI VDLQLEKKEGQLLTFAELTILIRTQEDKNASKEERMRKHFGMTKPANVYPKTRAISNQVSACAC DVSSTYSSEAGSLKKQVAEIQAQVATLKQSPDKKSIKGQSERAELVALKRTVEDLCVQVAAVKA SVAEGLKGNNPEQSEIARLQRQVAELQAQGIVQKAYQAPHMQRSPGTEIGRALKKEPLRTNRPR PGYCFRCGDDGHLAVNCENPANPPKVEEKRLKLREQQHQWDILHGRPAQFLN Gypsy-15_DR2p: MEAKLYNSRPGCYKQIPELSQTTVSFKHLPKGLVGTKCTAQVTIGGMEVNCLLDTGSQVTTIPH SFYKAHLSDFPLEPLKNLLEVEGANGQAVPYLGYIELTLKFPKEFIGAEVEVPTLALVVPDLTS FSQILVGTNSLDVLYGKCAQDCAADVKSSFPGYQAVLKVLEARWRQASSETLGYVKFKGNSPEI VPAGGMVVLEGQAHFNGPHTEKLVTLEPPSVPLPNGLLIASCLHTSPNKRLSKLSVLLRNTTQT DIAVPPKVMLAEIHAIQSVLNQHHQSSDAKAEESIPTCANLTFDFGDSLPTTWKERITKLLNSM PEVFSLHDLDFGHTKKVKHQIKLNDETPFKQRARPIHPQDIDAVRRHLQELLVTGVIRESDSPF ASPIVVVRKKDGSVRLCVDFRKLNAQTIKDAYALPNLEEAFSTLTGSKWFSVLDLKSGFYQIEM EEVDKAKTAFVCPLGFWEFNRMPQGITNAPSTFQRIMERCMGDLNRKQVLVFIDDLIVFSDTLE EHESRLLQVLNRLKEYGLKLSPEKCRFFQTSVKYLGHIVSHNGVETDPAKVEALKTWPRPRNLK ELRSFLGFAGYYRRFVRDFSKIVKPLTDLTAGYPPLRKSCNTKQKDCEYFNPKAEFDTRWTTDC QDAFDSIIDNLTSAPILGFANPKHPYVLHTDASTTGLGAALYQEQEGQLRVIAYASRGLTKGES RYPAHKLEFLALKWAVTSKFNDYLYGAEFTVVTDSNPLTYILTSAKLDATSYRWLSSLSTYNFK LQYRAGSQNQDADGLSRRPHGELVDDLTSLKERERIRQFTLHHLMESEDESPVVMAEVVKAICE KHQVVGSPQGLHCIPSVTLVESLTHCVDVLPYEFQHEDEHGLPSLPHLSQAALAELQRKDPELK IVIERVESGVKPCKLRELSSAVSLWLKEWKRLELRSNVLYRKRQEHGASSYQLALPTSLRNTVL QSLHDDMGHLGIERTLDLVRTRFFWPKMSHAVVQKVKTCERCVRRKTPPEKAAPLVNIQTSRPL ELVCIDFLSLEPDQSNTKNILVITDHFTKYAMAIPTRNQTAQTVAKSLWDHFLIHYGFPEKLHS DQGADFESRTVKELCKVAGIHKVRTTPYHPRGNPVERFNRTLLQMLGTLENERKSRWKEYVKPL VHAYNCTRHDTTGYTPYELMFGRQPRLPVDLAFGLPVDTPNKSHSQYVENLKNRLRESYEMATK NAGKIAERNKQRFDKHVVALTLEEGDRVLVRNVRLRGKHKLADKWEQNVHVVVKKAHNLPVYTV KPEGKDGPLRTLHRDLLLPCGFLQSNKLVEPPKQKPARKPLTRFSLNNEMQESDLISENSESEE EHIVSNVPEGTLSFETQIIVGPEYIPVGESGVSLTVLDPAVEDVSVPESVVSNPEEPAKKHLPG VEPVEKETNELIEVEKNSNALESSNTVPFVLTEKNSELEQSSELWSESPDQTAKNVLDSFEWET EQNLIPSNVGHTEILQNEQPTCNEPDDILLRRSQRERRPPKKFEYPQLGNPLTLVIQSLLQGLD TALCSSLEKSVVAPVRHL
Derived:
[1] (consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute