Repbase Reports

2005, Volume 5, Issue 1
January 31, 2005
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 1

Gypsy-14-I_DR

An internal portion of the Gypsy-14_DR LTR retrotransposon - a consensus sequence.

Submitted:
00-Jan-2005
Accepted:
31-Jan-2005
Key Words:
LTR retrotransposon; endogenous retrovirus; Gypsy superfamily; gag; reverse transcriptase; integrase; Gypsy-14_DR; Gypsy-14-LTR_DR; Gypsy-14-I_DR
Source:
Danio rerio
Organism:
Danio rerio
Taxonomy:
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Cyprinidae; Danio
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Gypsy-14_DR, a family of LTR retrotransposons from zebrafish
Journal:
Repbase Reports 5:(1) p.1 (2005)
Abstract:
Gypsy-14-I_DR is an internal portion of the Gypsy-14_DR LTR retrotransposon that belongs to the Gypsy superfamily. Its long terminal repeat is deposited in Repbase as Gypsy-14-LTR_DR. Gypsy-14_DR is characterized by 4-bp target site duplications. The internal portion encodes two proteins: the 572-aa gag Gypsy-14_DR1p (pos. 100-1815) and 1518-aa Gypsy-14_DR2p polyprotein (pos. 1845-6398) composed of the protease, reverse transcriptase, and integrase domains. PBS is complementary to Arg-tRNA. The internal portion is flanked by 99% LTRs. Gypsy-14-I_DR1p: MDVVMQEGIKIPNAIIISGETETADDEEFLKILQKHGSIVRSVKIQDPESEFNQDVIIEFDSGS ALQSLEPLLPYTYQLTSDPNITYLVRSLSSVYTQQLGGSATKSYLKGLKEIAKLSGANFEAMLS EMLTEMSAVVLPASSVSEAPDKPPITPSGQEPISGKTSPVMAQPSNEGNQEMHQTAAHVADSSV LTSPTILNPPEVQRLVVEHVVRSGEGVAQAHIPMRLRLFSGRKPRPANETDYDTWRSSVDLVLK DPAISDLHGSRKILDSLLPPAADVIKQLSADAAPSAYLQLLDSAFGTVEDGDELFAKFMNTLQD AGEKPSAYLYRLQAALNIAIKRGGVLASEADRHLLKQFCRGCWDDGLIADLRLAQKRDDPPTFA QLLLMLRTEEDKHTAKTIRMKQHLGSSKQRALMNTQRIWVCDEPKQSTDCNVLSLATEAKELKK QIATLQSQLAKLATKSEAPKKLASQTVDRKASFKDKKSTKPSVESTMPMHYKQTDKPRPWYCFQ CGEDGHIASSCDSEPNPALVAEKRKLLREKQSQWESQNNMAKAALNQSQFLLRDSQGLKH Gypsy-14-I_DR2p: MQSHSSKIKDGKLPRGLVGERCIAQVTILGQKCNCLIDTGSQVTTIPLSFYDQHLSETPINSIS DLLEVEGANGLSVPYIGYIELNITFPAEFIGTSVELPTVALVVPEPESCTMPLIIIGTNTLDTL YDEHLKTSSMTFQPSLFGYRTVLNTIRLRHKHNAGALGQIRLRSKVPEVMAAGQTVVLEGIAHM HGFPTDKWIVVEHPSISFLPGGIVVKNCLLTLPSRRYSHLPVVLTNETDHNITIPQRCVIAEIH ALESVLSSDNAIPKQGFQSDEPKVIKEEEFILNFGDSPLSQEWKDRITKKLREMPEVFAQHDLD FGHTQKMKHCIKLHDESPFKHRARPIHPRDIGAVRKHLQELLLSGVIRESESPFSSPIVVVRKK NGDVRLCIDYRKLNLQTIKDAYALPNLDETFSALNGSKWFTVLDLKSGYYQIEVAEEDKPKTAF VCPLGFWEFNRMPQGVTNAPSTFQRLMEKCMGDINLKEVLVFLDDLIVFSASLEEHERRLLQVL ARLKEYGLKLSPEKCRFFQTSVRYLGHVVSEQGVATDPEKIEAIKTWPCPRNLKELRSFLGFSG YYRRFIKDYSQIAKPLNELTSGYPPSRKSCKKAEKEYQYHDPKEPFGGRWTATCQRAFEILIEK LSTAPVLGFADPKLPYVVHTDASTTGLGAALYQEQNGKQRVIAFASRGLSYSEARYPAHKLEFL ALKWAVTEKFHDYLYGGTFTVITDSNPLTYLLTTAKLDATSYRWLAALSTFSFRLQYRAGKQNV DADSLSRRPHESLPEDQLSVKEFERINKFVEYHTMDTENPQNTDRDIIRAICEKHSVQQSDDSG VTLVESLAIHPDAVPECFEQEDSLNGLAALPLLMKEDLAERQRCDPVIREVVMCMESGEKPLPA LRLEYPDLPFYLREWDRLELIDGVLYRRRREGDSVNFQLVLPEDLRSFALNSLHDQMGHMGTER TLDLVRSRFYWPRMGTEVEHKIKTCSRCVRRKSLPQKSAPLVNIQATRPLQLVCMDFLSLEPDK SNTRDILVITDFFTKYAVAIPTPNQKARTVAKCLWDQFIVHYGFPERLHSDQGPDFESHTIKEL CAIAGIQKIRTTPYHPRGNPVERFNRTLLNMLGTLEEKDKSHWKDFVKPLVHAYNCTKHESTGF SPYELMFGRQPRLPLDLAFGLPCKDCKQVSHSQYVQSLKSHLKESYEVASQNARRIAEKNKIRY DKHVTNSSLEVGDRVLVRNVRIRGKHKLADRWESEIYVVVKQAANLPVYTVRPETKDGPLRTLH RDLLLPCGFLPASKIPDPVVSKPIVRHNTQKNPDSQILDSSVSVLEMDNDIPEMMCGAYPIDET RFTTVHQVLRPNVSDEVPHNPEVIHSRSADKVAQSDQSSDLPADVPEQAPPTENIREHLPVGVP TDSLPDVSEITESSPIPDAKSVNDQENSQEECSGQTQTSDEEGNDLLEDLPRRSTRQRKGPKML TYPQLGNPLMHVVHSFFQGLNTVLLNALDNSESLNDLPGKSNIQDV
Derived:
[1] (consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute