Repbase Reports

2004, Volume 4, Issue 9
September 30, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 246

hAT-1_SP

hAT-1_SP, a family of autonomous hAT DNA transposon in the sea urchin genome.

Submitted:
00-Sep-2004
Accepted:
30-Sep-2004
Key Words:
Autonomous DNA transposon; hAT superfamily; transposase; hAT-N1_SP; hAT-1_SP
Source:
Strongylocentrotus purpuratus
Organism:
Strongylocentrotus purpuratus
Taxonomy:
Eukaryota; Metazoa; Echinodermata; Eleutherozoa; Echinozoa; Echinoidea; Euechinoidea; Echinacea; Echinoida; Strongylocentrotidae; Strongylocentrotus
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
hAT-1_SP, a family of autonomous hAT DNA transposon in the sea urchin genome
Journal:
Repbase Reports 4:(9) p.246 (2004)
Abstract:
hAT-1_SP is a fossilized copy of an autonomous hAT DNA transposon. It is flanked by 10-bp terminal inverted repeats and share common 100-bp and 70-bp 5' and 3' termini, respectively, with nonautonomous hAT-N1_SP. The 595 hAT-1_SP transposase is encoded by 3 exons (CDS pos. 2100-3185, 3545-3702, 3967-4507). hAT-1_SPp: MPSKVWRVFTKVSSTTVKCTICDRVLGYKGGSTGAMLNHMKTHPNSIEDDRQPRLSSFNRQCNP DRAQRISNLIADMIAKDGLPINFVEGEGFRALMHDVEPDFTIPSRQTVMRILELKFLEQKTKIK HWMSGCEHIAITTDCWTSLGQEGFMTVTAHGIDKEWIKRSFVLNTSPVASLDDNDEDNDPPLPQ RHTSQALKSQLREVAQTWEINNKVCGVVHDNAANVRVIGEAVGAPDVPCTAHTLQLCVNAGLNS NGQLQRVIGAVSRLVGHFKHSVVASQALTAKQDQHNLPKHRLIQSVKTRWNSVYDMFARVTEQR WAITSVLSDERLTLHRDATTLQLKDEHWSIVDNMGKTLEPFLVATKVLSSEEHPTASTVLPMIT GLLDNFLIVEETDSGIVRQFKETTSEQLKRRFHIKSARERDEDVEIEDVSALHLASALDPRYSN LTYLPRAMRNVVKNKLNELIPERDDEEQNADVEQPSTSLDFLITGRRFTAPQQQRDSVEEIHTF FDLPVVPSTADAVAWWKANEASFPLLGNVAKRFLTIPATSVPSERVFSTAGNIVTKKRSCLLAE NVNMLIFLKHNAKSIPLI
Derived:
Positions 227 6532 Accession No Contig26222 BBBCM Spur20030922-genome
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute