Repbase Reports

2004, Volume 4, Issue 9
September 30, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 235

GYPSY6-I_CB

Caenorhabditis briggsae family of LTR retrotransposons - a consensus.

Submitted:
00-Sep-2004
Accepted:
30-Sep-2004
Key Words:
LTR; Gypsy clade; 5bp TSDs; GYPSY6-LTR_CB; Cb000288; GYPSY6-I_CB
Source:
consensus
Organism:
Caenorhabditis briggsae
Taxonomy:
Eukaryota; Fungi/Metazoa group; Metazoa; Eumetazoa; Bilateria; Pseudocoelomata; Nematoda; Chromadorea; Rhabditida; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis
[1] Authors:
Pavlicek,A. and Jurka,J.
Title:
GYPSY6_CB - a family of autonomous LTR retrotransposons.
Journal:
Repbase Reports 4:(9) p.235 (2004)
Abstract:
The internal part contains one large putative ORF and thus the family was probably autonomous. Flanked by 5bp target duplications. Related to GYPSY5-I_CB, GYPSY1-I_CB, GYPSY21-I_AG, and GYPSY3-I_AG. LTRs are listed as GYPSY6-LTR_CB. GYPSY6-I_CB_ORF: 22-4126 (1368 aa) TGDQAKAMADLTQQIASLISVFGQLVPSQATTSTNGSQLVESISTRIPNFIYEPDEDLTFDSWYNRYGDV ITKDGSTLTDEAKARLVLSKLNTKEYSHFANRILPETPNSLKFEDLFPKLKETFKSTSSIFRKRQEFLRT EYDGSSIEEYTGLVLRRFTSSEFKTMTDDQTCCMVWINGLRDNSYSDIRTKALQIMEAKPTCTLLELEKE IKRLLDVRADSKSVCSAAKQNEINAIHQKASSRDKSQKPPPSPCFKCGGKHWARDCQKQVKCTLCQKDGH IAKFCRTKKRDANVQKGNFSKVKSVIVGSATNSQRNRIYRVVTINGMKIQMQLDTGADVTLIRTKDWNRL GRPSLLAPTIQVKSANHQPIAVKGSFQCQFNLNGTSATGIAHVAETGTLLGTDWISKDKKLWNILNPSQI SAVHSDAGSACNYLDITRNRLKAELNNEFSDVFKPELGRCTKTKASLLLKPDAKPVFRKARSVPFAALPT VSEELDRLQQAGVISPVDHSEWAAPIVLVKKKNGSLRMCADFSTGLNDAIQLHQHPLPTADDIFVTLNGG KYFSQIDLAEAYFQIELDEQAKKMLCINTHKGLFSYNRLAFGVKSAPGSFQQIMDSMITGLEGTAAYLDD IIISGSTIEEHNQRLMALMKRINDYGFRIRLEKCTFLMERITFLGFIIDKDGRRPDPEKIAAVQQMPPPT NDGQVRSFLGFIQFYGSFVKELFRLRPPLDALTKKDAKFLWTSQCQNSFDRVKQILQSDLLLTHFDPKLP IIVAADASQYGIGAVISHRFPDGSEKAIYHISKALTAPQRNYSQIEKEAFGLIKAVTKFHKFLYGRHFTL KTDHKPLLSIFGDKKGIPLYSANRLQRWAIILLNYDFTIEYVNTNHFGQADALSRLISDQIQQKECEDRI VAQVESEVITNLVSACERLPVTANMIRAASKKDPLLNQVYKYVVSGLWPKIIDKSSQISFFHHRRDQLSI VADCIMFNDRIVIPSTLKARVLKMIHRAHPGIVRMKQLARSLVYWPSIDKDIENMVRSCDQCAAVAKNPI RNTLCSWPIPTAPWQRVHADYAGPLDGTYYLVVVDAFSKWPEVFPTTSITTTATINILRKVFSQFGDPQT LVTDNGTQFTSSGFENFCKDRGITHSRSPPFHPQSNGQAERFVDTLKRSLGKLKGEENADTALYVFLQSY RSTPCTSSPNGSTPAENFIGRKIRTFLDQLRPKDQLPNSHDTEMEKQFNKQHGARSRSYQVGEKVYVKDY RNINTATWIPGTIQKRIGQTMYHVAVNDTVWTRHTNQLRRRDAPIQFDVPLDTMDPIDVTPTATQLPSSS THTTPSPVNTPAKPKTPPPKQYRKSTRIINQPPRLVMKPNQKSYH
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute