Repbase Reports

2004, Volume 4, Issue 8
August 31, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 215


Caenorhabditis briggsae family of DNA transposons - a consensus.

Key Words:
DNA; MUDR superfamily; Cb000282; MUDR5A_CB
Caenorhabditis briggsae
Eukaryota; Fungi/Metazoa group; Metazoa; Eumetazoa; Bilateria; Pseudocoelomata; Nematoda; Chromadorea; Rhabditida; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis
[2] Authors:
Pavlicek,A. and Jurka,J.
MUDR5A_CB - a family of nonautonomous MUDR-like transposons.
Repbase Reports 4:(8) p.215 (2004)
The consensus sequence was reconstructed from the Ensemble genome annotation. Copies are 99% identical to the consensus. Contains 220bp-long TIRs and is flanked by 9bp target duplications. The central part contains an ORF with no clear similarity to known transposases. One variant listed as MUDR5B_CB. MUDR5A_CB_ORF: 3719-4430 (237 aa) MPRSSEYSRKVLDFTVEEFANQINQRRKRRKKIPDRKYSKRSHNNGGRTVSEFKKVNRNVSGESESGDDE RKADGNISSDEENDSDCDVNSLNSKPNVFDESGDIVEDEINCNSNDEHVNLVLDPSVDHLNSHDSCMDLS DDPRKYDSDSDEENDIFGYQNVNPVPKPSNRVSNDHSSQIDLRDVLGEKGSRKPESDSEEVTDVSTGQHV KPMSLKEKFPIGYMHRLSDDSDDSETK
[2] (Consensus)
Download Sequence - Format:
  1. Stein,L.D., Bao,Z., Blasiar,D., Blumenthal,T., Brent,M.R., Chen,N., Chinwalla,A., Clarke,L., Clee,C., Coghlan,A., Coulson,A., D'Eustachio,P., Fitch,D.H., Fulton,L.A., Fulton,R.E., Griffiths-Jones,S., Harris,T.W., Hillier,L.W., Kamath,R., Kuwabara,P.E., Mardis,E.R., Marra,M.A., Miner,T.L., Minx,P., Mullikin,J.C., Plumb,R.W., Rogers,J., Schein,J.E., Sohrmann,M., Spieth,J., Stajich,J.E., Wei,C., Willey,D., Wilson,R.K., Durbin,R. and Waterston,R.H.
    The Genome Sequence of Caenorhabditis briggsae: A Platform for Comparative Genomics.
    PLoS Biol. 1(2), 166-192 (2003)

© 2001-2020 - Genetic Information Research Institute