Repbase Reports

2004, Volume 4, Issue 7
July 31, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 201

RandI-6

RandI-6 is a family of non-LTR retrotransposons - a consensus sequence.

Submitted:
00-Jul-2004
Accepted:
31-Jul-2004
Key Words:
non-LTR retrotransposon; RandI superfamily; AP endonuclease; reverse transcriptase; RNase H1; RandI-6
Source:
Chlamydomonas reinhardtii
Organism:
Chlamydomonas reinhardtii
Taxonomy:
Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Volvocales; Chlamydomonadaceae; Chlamydomonas
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
RandI-6, a family of RandI non-LTR retrotransposons from the Chlamydomonas reinhardtii genome
Journal:
Repbase Reports 4:(7) p.201 (2004)
Abstract:
RandI-6 is a family of RandI non-LTR retrotransposons. Approximately 50 copies of RandI-6 are present in the genome. They are ~1% divergent from the consensus sequence and are likely mobile. The RanI-6 elements are usually flanked by 10-15-bp target site duplications. The consensus sequence encodes a 4527-aa RandI-6p protein (nucleotide pos. 44-13624) composed of the AP endonuclease (aa pos. 2010-2290), reverse transcriptase (aa pos. 2660-2960), and RNase H1 (aa pos. 4025-4190) domains. A 144-aa portion of RandI-6p (aa pos. 1463-1616) matches the Josephin domain (E < 0.001; pfam02099) and is conserved in other RandI polyproteins. RandI-6p: PARTHRLAPTGPSPEDSVAEPCPSLPSNDQKLGKTGAGSEAANCPGNAETRPVARLPCKGASHP YHKGHGSKLLGITVLRRDPEPTFSRSSYRPDFHQPPRARQHPLSDGKTKQQHSHQQRHTKKAQT SQTTTSQTPRNARAPRLTTNNTQQHSVTPQHQHTRTRPLEPTQDNPTPKNPTPDNDALTPRKLN SQRQNNPTNPQNTEIKRKPLPSHLSSFCFLTLTLALPMLLLTPFASIELTSAPQMHTSPVTLEP ASAMRPHAAAGLTQTAAPSHHASLSLATKMKPFHVDFTGDIILRPDLHYLYNAAGLTVGILHPL PEGNIALWQTQRLRPAAGPIPASVLGLADGKQRILLMTACAGCLNRAMSLSSLLEPAGNYLRVI QQNLLHTKIDPRLRQLAEAAITKFNEVLSSRGDLVNSIADAAIKAIGMPATNEAINNIRSLIYE ARAGSQTWTLSDNQKVAALGSKRTAFTAGELLLHSACITRHPILILLLTRRHCLAVAITLPVAH AAAFLLDLQTHERWILELGPDNSITPAKRRPTVAILAGASRSAPNSEGKVSFLAASEGRHDLEK VITCSYTTDQAHSPVYSPLFRHAPNYRLKCSQLLPAYTSTTPPYPQVLPFTAIMVVQCAARAQD AAGDPNKVVAHMAYEAMDKICAGKPTTPLSTIVEGTKHHSKAPGNYTSTQTYGSSPPIAHALSP NTPLQAPPTPPPVMPRSTEAMTAKDPGETATANIRDWWGSPLGACVDVRFVKLHDADLLASLGA NRNQLYGDVFYAHFSSADVCEAIQRTGGLYLFSDTAYLRAVCLQSRPDGGAATPEMMDLLEEIG IQIELLDPLLSDTGVNELGARVAQQLEQGMKALFPDIAQHDHLTNRIGLYTTFGTVQSLTTLDR DNPVEFLFARKGGKLAPIIDLQPAAWQANDRQLFHLSDSRLYLLPCNALSAAAILICINGGRNL ASTMLWPELNRGRVYLTDAALDYQYKLNTGSADELWEHPCAHLGLAAGLALTGQAGAGMVPDFV GAKPIHAARAKTAVRHQLQAADAPEPLPMPGLQLNLGESGPVLDAKTVEAAAEDEMEEMDLASL LVSSALGLKPGSTAPAFTASTTTHPSSTHPHLTDKPTESATPPNCLTPHSSQCRAPSASAEPTP RHNAPPATCRLGRLRSLPHTPGYAGILINASGYSGTHSTAYWDRVAQTRVAQVTEQGNDAGSSK DRRMHDYAVRQARGDVGPDCAVVTMHGTIGTLTVLTHAGLARDTNGVCREVHLAQINGWTNGPL ASRMLLFYVFLLLPIAFRRYGQYARGGPKDDKCVSAAVDSILRAADGRLRPGLLAEDSKANCTR AMRVRNPPLHIASCSQDNARPSVIRRHHELCLAHATATRRTNSPALTKTRCCPPSPARIRLYFP HASRSAPRPKPPALADARQAVQGQAKGRGTQCLLFTAGSKPPASSSAPPSSHSGRIYFEQQELS FCWIHAINNLLGAAAVSPHRVLLYLEQLLRQTRGRENTTEIFALSQAFTPAIGQFSIHAVNHYL MYNCHRANQALALHAHDAVRPGDSPHSVTRRHAQATNGFLIFTPGYSSGIYGHVLAVKRHGANW IILDSADTQPRTIQHTTTLDMAGTIFTLSTRTPDTPPLLPLCLNGIGPPANWAPDRMGQPSFRA LNQLANHLTANGHQLLDTCSWGNNCAIFGTLAVLPGSRVPLIPSDPAQWAPMTGAIRACIASRL EHLTAPGTPGSDEMRTHILGLYEESPHPENTIRTHCRNIRDTSMLTIPDLIALQSLLPGVQIHV ISPGYTDWLTLPTPQPNDTRHDVYLAHVPHSWALAGFPTAFPVTDCNHYIAVTRHTWTPGSVTQ DPSPLFHESIWDGGPCTRDIIVTHAKSPTRSPLPKKARTNTITHALLRAMGSPTNPRKAAKRAL SLSPPAPRKTTRATTNCEAKRAPNTRAPANPHTPTATPAVTNISPQQSPPAAPPNPPPRLAVKA RQATLQAFLKAAQAPREDPATQVAPTHTDACHLVTLNARGLLSNLTAIRDELETWDADILILTE TKTRAHRTRTERDIIKNSLKAYTSFVHSTPRPPPLKGQKQDPRRHHPSGGVTLAVHTRYARKEH ITCLPTPAQLQGYMVHLRIATHSSLPLHIIGIYCPPDNKSTRDALYTYITRATKSAARLKEPLL TGGDWNAAAYDTDRSTRTGTQGDKTHQTFLTRTSLKPAAGAHTQPRLYTYTQIQHDTITHESRI DDFLANTHALRQDSPAREWTTECAGTTDHLALHLQTTLPYKPPRDASPHTEREPRRQPDDASPT LANIVKPITQSQSRAISQQWEAEGTTALVTLHATLALPNCSAQQIIDSTVAAISHHTNSTASTR TAHDIITGARAQLSAIDLNAASTALYGALAVGAKLMLQTCPQKPPRTSRAKPSRTEAKKLKRLI AVEKQKKQQYLALVRAAQLQEPAIPPPTAPNPSQPEPPATPAPATAARQEWQDALKTRRTTQKE TSAKAASKWLTKISKLFATSQSKAAKIMLGKSGPRQNLTAVRHPATQHIATTSSDINDALHAHF QAAAEPTGGQRTGRYRPEDKDTTFPWNEPGAPDGGFLLARTAHPDAQSLLPNVADSSNFQRCMQ ALSRNKSPGPDGIPNELLKCMPEALQSAVHTLMCVAWIKAELPAGWSTSDTILLYKKADPLSIS NYRPIALCNTLYKLYTSLVTRAATEACTDLLIHSEAQEGFQKHKGTERQIMNLLHVIEDAALTK RDLYVAYIDFSNAFGTIDHDRLLTIMHHLGLPTDFIEVVRNLYSSANTTIRTTHGRTNPVHIRR GTMQGDTLSPLLFIIFLEPLLRWLHYGGRGYRYGCLTNSENDEHNCSSLGYADDLTVAANSRDN LRCQTDKIARYAAWGGMRINRDKSACTGILHHYASANSTDKSIKGPACDRTLKRLLAGHIHVGT CTKDGKRSAITLPYIPPHKPYRYLGVEITMTHPQLKAVKADLTDAGVELSRYRKLPRQCYMLIK QCLKAKVAYSLPTMAYTQPDIRALDAQIAGIARRCVGLPRDCATRAILLPAELGGLGIGSLREE YVQRASRLLVISLNDTGRLGVVTRRLLHLQAAHAGSDLPLHDMKRAGQFFVTLKQLTLLQDHDL LAMLQGKEFTAALPALVSKLRAAEATTPAYLRADWISPLTIDLGLNLADLVDANTGRHIIDTTQ LDRRFPKGRVKDKHKRALNRFTVALCKPAEAPPKSMGHKPLPMQSRTLPAGVSKADLNSAGDLP KPIPQRTLTSLLARWQEALPSPAAPPKPSLEVLQAKPKQTAKQRHSHFIKHDTRTRNPEVEAND DALPGSTVHDPSDPTKDLAFYMSAAREFAPLAQQCKTLGTTRWTGTWRSPIRQMPARALITGPH THTVHALLHTRPYQQPAAPTYQRLYLPDGCPATTPPPAPAHSHNRRKRGSQPTRCPYTHHAIQP RAPTRAAAPRRDSAAAQPSSRPAWRKVRDNALNGRLPQSIAGVQAAQHITAHLTNRDDIIAAVV SGPMTHKTNAPPPKRKRKQGPPPEEPPWAERCRYRVRWQPTLTTNGILRAYELQNYNATSTTKP PCRLWGQGIRRFMVQVHWAETEDPLSSLSENPGWAAALARYTLAQAVDAPPDPTPPPALDNHLT SKQRQGRWRDPAPSEAARKRAILRCSTIDVKSCNPDTDIHPTGQYCIQMGTREPGSATGTPSGP PQDPDPPARVYGPDGRCIGTVSAARLALLHARYRTLNPTHPPERFAAALASLIIRYRPSKRHKE SSTNPAHEVTLCPDLMSTLTSHIKFQTEAFASPLNAHCDIPAYYTTHPQDSEFGAAHDCYSRTL DGISFVHPPPQPEHTSLAMAWAVASAEAATPHTPHLSVVVVPYGDTSGYTAWLQHPLVHDLGHI KPAHTWAAMASGLGQPQELPAHRRGLHLLCVTNERGRLLLNQALESGLALALADALGHTPHLAT RKPPTDPDTPNPWPPTPRKLKRRILAQSSQTPQPQPPRDAPTLPSPTELATLYRAYVPLAHTRG SAVFTDGSKVPHTREYTGLGAAVWDASDNRATHIDEDIAFNTPLSTILRCESSAIRTALRLHRD TPHLRVYTDSLVSLFILRRAIMEPESLHVSKHREMFGTIVDQLAERALAGHKTSFYHVRSHQTD TCVGNQKADEAAQAVATRTVQPDATETLYSHPYEPLEGWIAQKEIVEHNGNLEERLRYANDLNR DLKKMARKSTATGYTKSGLYAELWEAARKHIDERYGLNLFDKFSFEEARCAFKYRWGLSWNAKR AARVKHPMPGCAGGECPLCRGDDGGTHTLGGCTHPRMKAAYIARHNRAVQRIAKAISQGHYGGC VMYMDAGKDAPTYSGGTRIPAWMLPSTPESVRKKLRPDLLVIPTLRMHRSGLPARAPRTRRQRS AHKVYVIEVGYCSDLNHPDKRAEKLQQHEDLVAALRDAGWDVMYSPDTVISLGHTGTVTPHLHA LLKTLGCPTQSAHSTCRKLVQHAVHTTTAITALRREIYSHKWPGRPP
Derived:
[1] (consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute