Repbase Reports

2004, Volume 4, Issue 7
July 31, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 200

RandI-5

RandI-5 is a family of non-LTR retrotransposons - a consensus sequence.

Submitted:
00-Jul-2004
Accepted:
31-Jul-2004
Key Words:
non-LTR retrotransposon; RandI superfamily; AP endonuclease; reverse transcriptase; RNaseH; RandI-5
Source:
Chlamydomonas reinhardtii
Organism:
Chlamydomonas reinhardtii
Taxonomy:
Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Volvocales; Chlamydomonadaceae; Chlamydomonas
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
RandI-5, a family of RandI non-LTR retrotransposons from the Chlamydomonas reinhardtii genome
Journal:
Repbase Reports 4:(7) p.200 (2004)
Abstract:
RandI-5 is a family of RandI non-LTR retrotransposons. Approximately 50 copies of RandI-5 are present in the genome. They are ~1% divergent from the consensus sequence and are likely mobile. The RandI-5 elements are usually flanked by 10-15-bp target site duplications. The 5'-terminal portion of the consensus sequence is incomplete. The consensus sequence encodes the 2457-aa RandI-5p protein (nucleotide positions 1-7367) composed of the reverse transcriptase (aa pos. 460-750) and RNase H1 (aa pos. 1930-2100) domains. RandI-5p: XXNAADRTGPLDSADRLHQRFLAQTGLLPARGTMTTEGEWSYEQTQHGVTTHRSRIDDILMCTT TLTACPSPHEHVSTVAGNFDHKPVHIKLPADALHLWEAPQPAAPPATTSEDSPRWSRVTLPITK KQLAAAAAHLEDIMVEATADLHNASKGAVQVIDNALKQHTKNPTTYPANTMQWDLAHNRIVQQT DVNQLAERLGKALEDGLTCLLEECTLKPPHTGKHHLSRSAARHLKPLWDKEVELKQTLTNLTAG GAAPDTTTEGEAATIRGQIKDCQAQHRQLVADRAKAQREAAAAALQHTLATRPAHGHKRIFQKE ATERGLPAVRNPETGEVVTDPPSILTALDGHFRKLSAPPRGPRTGEYRLSPGATRGYPFELPNA TDAFTLERNRHPEAHSMLSSMADPANFDHCIAHLSRNKATGPDGIPNELLRILPHGMKRALHNT LKIMYVKSTIPESWATSDTVLLPKPGDALDIKNKRPIALANTCYKLYTSMLTLGIGELAGPLQL FSESQEGFRAYCNTERQILNLVHVLEDAALYGKDVYAVYVDYSSAFNTIDQDRLLQIMFDLGLP DDLIRAVRNLYAHATTRIRTEHGCTSAIPIERGTVQGDTLSPVLFILFMEPLVRWLHAGGRGYR YGCLSPEDNARYHCSAAAYADDLAALTTTLEDLQIQCDKISDYADWASLRVNHTKCAATAIWHN KSRSTPTLDGPTGQATLNAMHRELTNKLRIGNTTVPYYPPTKPYKYLGVQLTFSLDWKAQVSRV TETVKEKGTAIATSLATPAQRLRMLQQCVHTSIAYAFAAMPYTKQDIANFDATLAGYAKRCYGL PRSFPTRTTLLPIDEYGLGLGSLLPQYARVANRALVLALNDTGRLGVVTRALLPRQHSLAGASL AHHLPADRGRFFTTLQQMTLAREHGIQLFYKGTPYATPTWSIVEALDAAAAARAAAPLPVEHVL PLAELQLEFSHLVDRNTSRHLISTRELEKLLGASRVRHKHKVALNRLSLALVATAGLDGDQMPP EKHGSPNPLPPTQRVIPPLEELQALSARNDPRPPGMAPPLTALMTGGPAPQPLTPAPNTTTQMD IEEASPLYHNPPLQYTPTALGQMAPTPAPAADTAAPVAQPEANLRTRPRKTPVMRTPTHPTAHS RRVTKHAAQKARIAENTRTTPDDLLTGDKAAISTAMRLTNGDESLAVGTRGYETARSVFTALAK DMSRHNHLCKPHPRDPPSFNNRTPVTRTQRPLAPAITTLLTANATMPSTGAVQTYLHQGQPAAA AAEDPMDVDAAAPEHDQMEVDDSQHDLMEADDRQQASPLRLSRRRGKQTIWKLARERVVKDLVH PPTDDCTNGDAQLTYDLDNDGQELAAILYRTNQQTATDKEIARKRKAGEDTTNTREPYFAVQWK PSVIPPGLVTAFSRMGYATVTDVRCYKHPLQARPRATQPHPDGAGTTDADTATAAQPAGILPAH APPTAPAPGPLETTHAPRAALFSSRSTRLLRQVTWANSNERERDLKHDLEWEELISEYTNRLAA GPDAPARPTRPPKDRNLTMRQRQGRHDDDPDDQATRARVTRAATTISTVPSDPYHDVSPPGSYA ITTPTAGRALPREAHVYEPSGRWLGMLTYTRLQTLWESFNRTNNNRTKAFEEAVAALLHRYRRD PGQTDHKTAPQHQTSLPSATVRAVVRSLRNTGRGRVKEMFASPLNHTTDADEYWSREAADVVFG AQHDAYSTAWTGLHYAHPPANPDASRQALVWALASAETVNNSPEPTLTILVLPKCATYPHTQWL THPLCRRLATWTNGELDSPGTAGMEPGLGTDVPLQKQRGAILVAVGNTAGLNAFTQSWKGLRSS LVAGPHAPATVADTHLGSGTLNTSCPHIPRHTSKHAKYLATHLNIATVVTPDEAPATPRLNRTQ FQRTLPLAHNPEEIVWTDGSVSKTTTENGRELQVAGACAWHKDRVVYVNPNGFGCTNTITRAEL AAIRAALEEFGGETSMFAKKTLTIASDSAASLYLIKRAIDEPRRLHLSKHKALLSSIADLLHAR AKRDAHTVFLKVVSHTGLHGNEEADKGAADVATSTKPADVSELADNNPHAAHWWPATTRTREDG STTVHYISDLNRGLLKTLDPSSHGGHSKHTLYTTKWAESAPHLDTRASTAYMTHPGAGHSLRRF IQNARQGGLICPARLALFKLRASDTCALCAPIHQRAGSPPERGNAGHLAGHCAHPQLVGARIAK HNAAVRMIAECLHHGANGGGYMLMDASSADARPEYCAGTCPPKWMLRNNIPEADRKRMRPDILF IPSLPRSDVGASGPRGLTTAGRRQHKVYLIEVGYTSDLHHSEKCDQKQAQHTRLADALRDAGWD VVYKKEQIVTLGHGGTVSNTLEPLLRSLGATTTSAKSCCSRIHMHSVISLRTTSLLYYRLEREM GIVNSRQVGPTGGATAAGPSPRDPG
Derived:
[1] (consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute