Repbase Reports

2004, Volume 4, Issue 7
July 31, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 197

RandI-2

RandI-2 is a family of non-LTR retrotransposons - a consensus sequence.

Submitted:
00-Jul-2004
Accepted:
31-Jul-2004
Key Words:
non-LTR retrotransposon; RandI superfamily; reverse transcriptase; RNaseH; RandI-2
Source:
Chlamydomonas reinhardtii
Organism:
Chlamydomonas reinhardtii
Taxonomy:
Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Volvocales; Chlamydomonadaceae; Chlamydomonas
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
RandI-2, a family of RandI non-LTR retrotransposons from the Chlamydomonas reinhardtii genome
Journal:
Repbase Reports 4:(7) p.197 (2004)
Abstract:
RandI-2 is a family of RandI non-LTR retrotransposons. The 5'-terminal portion of the consensus sequence is incomplete. The reconstructed consensus sequence encodes a 2064-aa RandI-2p protein (nucleotide pos. 2-6193) composed of the reverse transcriptase (aa pos. 90-350) and RNaseH (aa pos. 1570-1730) domains. The genome contains ~100 copies of RandI-2 that are ~1.5% divergent from the consensus sequence. RandI-2p: XKNSAPDTFTLHSATTPPTHALLPSIADSTNFDSCIDHLSRNKSPGPDGIPNELLRALPQTLRT TLHNLLTLMWVRAHTPASWTASETVLLPKPGDPLLLKNYRPIALANTTYKLWTSLITVAISDIS HDLDLFSETQEGFLRYRNTERQTLNLVHALEDAGLTKQDIYVMYADFSSAFNTISHDRLLEIMW DLGMPHDLIRVVQNLYSNARTYIRSEHGLTAPIYIERGTVQGDTLSPVLFLVFIEPLIRWLHVG GRGYSYGCLPPHLNARYNCSSAAYADDLAVLTNTLSDLRIQCDKIHRYSEWAGLQVNHAKCRVT GILHRRAMQDKGLNGPTCNRTLRSMLENKIHIGTTSIPYLPATEPFKYLGVQVTMTLNWGPQFA YLCKNITDKSLSLQTCQASPEQCLRIIKSCIQSVAAYSFAVMPYTENDIRTLDNMIARLARTCY RLSRGFPTRAVLTPAEMSGLGVGSLLPIYVQKATRALTLALNDPGRLGMVTHALLELQTRIAGT TDMHKLRHESHYYTTLKQLSIMRAYNLTLWDHGAPYKGPPNTLLTAISRSPHPISHHLVLTLTQ AGLDLRNLVGKERTPEGRACLIPSDILFQHLPRNQCQHKHRVALNRLSLCLSAECDGAREAPFN QAESYKCHLPLPQRYRALPNTPAFAALLPRNATPGELTTQSTMDAHLQHMTALHPNTEAQTPQH PNGLGPRQRQTTLAHMLRTTGAPPTAPTQSPTATLTQTPTGTLPTPPLAQPMPPPLTQPTPPLT TPAGPDAPNTQTPPTVASLTTAHQQPKSKKQRPNAIKRLQQKIDADPRHDPLPPTDMRSHTEKS GFILNNDPDENDSGPPNFVMWAPHYFANVQKDMQGTNRMPRLGIPRHHSRFPQNRTRPNPTRTI PAHLADPYFLGSQVDDTNPLNPVTAYISANPPTTPPTCAYDSRPRWADTGDFMIAPEPPNWPNI TGATPGDSHDPRQADHDPQGQMRAEYMQERERLRAHLDDHPPQPRPFKRWMGIRLQLLTGKLPW PTQAYHVAQAAKQLVYSLYHDIEEISHIQAGPITKAVTAPEKGASLHTERYYEVAWKDTTIVKG AAEAYTRMKYTGTAAAHMGYGQACHKYFLRMKWDPTSEPVDKCPTLQGWTPAISEHLRKLAEPP TPTPQPKPKDARLTPAQQQGRWTQADVAASHVRRTTKQNTRIDTNPCNPYLDVHPTGRYTIQIP DTYTDERTLAHVYNPTGRHIASVTLGTLLTLKARYEHALSTHHDATSPHRSQGGFPEDLAKLLL RTRVDSKGKTCKSAPARERSLPESLKLALYNCLASTHSDPDRPVGLVERFASPLNCSGRATKYY SQHAADSLFGASHDAYTAPFDGLSLAHPDPDPDACTKALAWATASIEHLEHQATPAITFMIIPQ GKGAASRCLASPHVTILALIPPGVSASSMLDGLGAADEAASSKQGLQLLLIANTTGVQALNSNN NLTRLQTSLAELGAVPPPTSQPPGRRQPLEWPARVTLPRDRTAPPGRPYSHRAKARAKQLTRPQ APAARGLDTCPTPMPTLSALYTTRAAFPTRSSYLYDAATIVWTDGSCIKVAAGEDGNEMNKLGA CAWSQQTEHIYVEPGGLNSTNTIQRAELSAILVALEYIRPRLCLLGMTQVTIASDSLVSLYLIR RALTAPQRLLLSKHKNLLENILHELQMYADAGVPVQLLKVRSHTGLHGNEEADKGAAKVAANDM EAMGQAIRLAPDEPWSNIWWPKRNSDNFYLSDLNRGVLNSLPPEAQQGFTNNTPVLEQWAEASA NMCPTLSNRTLASSTRHPWLVKQILYARYGYLFNAQLKRRYRLGGNGNCPLCHTPDSGGHILGG CTHPKMKGAYINRHNWAVQRVAKCISKGTYGNGFMVMDAGPLADLPHYASAQRPPAWLAAERTS SPLITRLRPDILFIPNLPAHETHREGYRPPLNKARLPIYILEIGYSSDVRHLDKREEKSQQHQE LKRLLEAAGWTVHYSTNECLALGVTGAIPCNLTKLLTSQLGVTHTAARVCGERLHTHAVNSAGG IIKMRRVTEQELKPRGG
Derived:
[1] (consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute