Repbase Reports

2004, Volume 4, Issue 6
June 30, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 186

Mirage1_CB

Mirage1_CB is a DNA transposon that belongs to the Mirage superfamily.

Submitted:
30-Jun-2004
Accepted:
30-Jun-2004
Key Words:
DNA transposon; Mirage superfamily; 2-bp TSDs; transposase; Mirage1_CB
Source:
consensus
Organism:
Caenorhabditis briggsae
Taxonomy:
Eukaryota; Metazoa; Nematoda; Chromadorea; Rhabditida; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Mirage1_CB, an autonomous DNA transposon from the Caenorhabditis briggsae genome
Journal:
Repbase Reports 4:(6) p. 186 (2004)
Abstract:
Mirage1_CB is an autonomous DNA transposon that belongs to the Mirage superfamily detected previously in the C. elegans genome. The consensus sequences was reconstructed from several 99% identical copies. It contains 15-bp terminal inverted repeats and it encodes the 1039-aa Mirage1_CBp transposase (pos. 420-4479; 13 exons). This transposon is characterized by 2-bp target site duplications. MirageN1a_CB and MirageN1b_CB are nonautonomous transposons whose autonomous counterparts were relatives of Mirage1_CB. Mirage1_CBp: MPRTTHKEVRPFHGMGSNDTSSQERRVGEDDVPYAVKEMATLEDTSNVDFEMELEDMDKDEDTD EDDGGQTEFERLLTSQEDTFAEEARKLCNKCVDSATATFVRIGSRSQLKELVELYIDKIMEIRK QLKEGKNIVHNLNSPFFSKYWKAELQNHLNLSTVISIDGIQISGNKKKLWPVSLVLVDLPSSEM QKSCNLILEGAVECSENPSTLLWNAIFGKIRSDVEAHTGRVGTITYDCKITTCCADQPAKRSFF GMKGHSSSMSCFYCLSEETLYKRGGVSRKEQRYGNLTVLDSKNGENGFSSKSSKVVEVIAPYNT PIDILHNTGEGLFDRIRKAIPLFPEIFPPDTKFIRKSDLFVIDPSSFARDIRRVYLHSNYENIE NLRNGSDKTHVGDCKITVQNFRFQHLRLTLALTALVSDSMKPKARLVLIALGFLTNKMYSNTQA PTLFDIQLSAAAAWYLAEANKEYITMKTHELLYHLADVNKLFGNTGLLSTFSFESFYQFSLCGY STSITRFFLQNACTKFVHYFHFINPQPFNKFRFLLHTSLRREIVRRSKPLGTESLKRFLSLTPD LGSSHVTWDGRIRDVQKIDKENIPIESVLYSTMYLPLGSLISEYSSPQTNNDIVFASCKGRKTC FRFVAAVVTTSLVGALVEPIEAVSEDRKLMDLRKIRNSLSNADFYYYSEMVNQLINYEGLVEGS LSGRREVIPVDSILGVACYAMHYLTPNRSSRPAPYRLPLTTRTSPSTSSSSRLFVDENQRKHAR GTDYTRGNLYTATVNQKWSPIGFAATQLYDMETGSAFDRETCERNIEKMIKNDRDIDYMEWLNL ASKCREEGKDLLEKFSLGMATQTALSNARNRRAPRETKTVSNLVGNIEKRGFSLDSAKCFDEEL ELPSRKTFRLSDILTENVVCNWTSTQFDAHTKRLALHVWDAVDNADELLVCYGSSQKENKYVPV NPSIFTKMSGKITNQYVIKSAHTQTTSSRVLVKRTAKTEKPKNRVRARYNAKFGKSQSEQAAIW LHDELMKGEASELKS
Derived:
[1] (consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute