Repbase Reports

2004, Volume 4, Issue 6
June 30, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 175

GYPSY68-I_AG

GYPSY68-I_AG is an internal portion of retrotransposon GYPSY68_AG - a consensus sequence.

Submitted:
30-Jun-2004
Accepted:
30-Jun-2004
Key Words:
LTR retrotransposon; Gypsy clade; mag lineage; 5-bp TSD gag; AP protease; reverse transcriptase; RNase-H; integrase GYPSY68_AG; GYPSY68-LTR_AG; GYPSY68-I_AG
Source:
Anopheles gambiae
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Tubio,J.M.C., Costas,J.C. and Naveira,H.F.
Title:
GYPSY68_AG, a member of the mag lineage of the Ty3/gypsy group of LTR retrotransposons in Anopheles gambiae.
Journal:
Repbase Reports 4:(6) p. 175 (2004)
Abstract:
GYPSY68_AG is a family of gypsy-like LTR retrotransposons that, according to the aminoacid sequence of its reverse transcriptase, RNase and integrase domains is phylogenetically grouped with representatives of the mag lineage of other organisms. GYPSY19_AG, GYPSY20_AG, GYPSY21_AG, GYPSY22_AG, GYPSY23_AG, GYPSY24_AG, GYPSY25_AG, GYPSY26_AG, GYPSY27_AG, GYPSY28_AG, GYPSY55_AG, GYPSY56_AG, GYPSY57_AG, GYPSY58_AG, GYPSY59_AG, GYPSY60_AG, GYPSY61_AG, GYPSY62_AG, GYPSY63_AG, GYPSY64_AG, GYPSY65_AG, GYPSY66_AG, GYPSY67_AG and GYPSY69_AG, are other members of this same lineage in Anopheles gambiae. The GYPSY68-I_AG consensus was reconstructed after multiple alignment of 4 copies. The consensus encodes the 345-aa GYPSY68_AG1p gag-like poliprotein (pos. 958-1992) and the 1024?aa GYPSY68_AG2p pol-like poliprotein (pos. 2430-5501). The sequence of the LTRs flanking GYPSY68-I_AG is deposited as GYPSY68-LTR_AG. GYPSY68_AG1p: MAGWTVENNLECALEVRSESKEKDYKGDFLAGSWPLKPFSEELPIHERKAEWARFKGQYERIVM CKGKVNSEMKLIALKVFAGSYLLNIIEMQERRVKSGEGDVYTETVKGVDDFFNGICDEGKERMK LREMKMEADETFGDWVLRLEAQVKFCGLPEEQKTEELVQAVLRRSVPQIAEKLFEMADLFGNEL DKLVKHGKHLDFVRMEKREIEQKLAKSTTKEFTDSDNYVAAVTSWRTKRERYEPYEQQQNKRLS GMHSNGFRNTYNKGATKCSKCDKIHGWGKCGASRSKCFRCGAIGHLAICCRTRLGSNRFPNVVK KQTEDINQVVIGDPAAERYQKKKNK GYPSY68_AG2p: MIGNVPIIFLLDTGASVNTVTAESWWQIRTHAQSSVREWQPHPETTLRSYANSAVLDVECSFKA IICAGGTNRTMAKFFVVKGAEISLLSFNTAVSLGLVCIGPGKHYMLRNKTQETTVKDTFPKLNI GAVKFRIDKTVTPKQIIRYNIPKAFERAVNERLEEMELNGIIEYVDSEDAEISFVSPMVLVPKG NKDFRIVIDYREANKAIIRDPYPMPSLERIWTDIPNNDGKILFSKIDLKDAYFHIELHSEVRHL TAFMTMNGLMRFKRLPFGLSCAPEIFQKEMEKVFRNCKNVLIYLDDILMYGKSLKELKEIENMV REVIKKNGLTINEEKSCYGQEKVNFLGLTLDGEGILPMREKMTAIQNFDRPKDAGELRSFLGML TFIGPFIRDFSHKTKPLRDLIKRDKFKWEEMHQNTFEELKKVAMEDLIKRGYFNEKDRIILYTD ASPWGLGAILAQEKLSTSEMRIIACASKGLTETESRYPQLHREALAIVWAMERFAYYLLGRKFL LRSDSEALKFMIKPAKQKDIGKRIMSRAEGWFIRLDHYDFDFEHVPGNENIADTASRLCRSKED YQFGVAKEPHELCLVTACVNQVNETLLALTTEEVGKELEKDVILNKVIAWLDKENEWPQEIARY KAFQRELYVENGFLFKQEKMVLPHILRNRALTLAHRSHPGMSTMKNVLRTGLWWPGMDKEIEAF VRSCPECQLVKTTNTAVPIELTELPENPWDYVSMDISSTTDNVKTLVLTDNYSRFLIAVPLERT DANSIQKALNRIFLTYYVPKKLKADNGPPFNAVDFKRWLADVWGIKLINSTPLNPTENGLVERG MQGINKIAAIARLEKKCWKQALAEYVADYNSWPHHVTKIAPAELMFGRAIRHRLPNPKTDTRQA NDDELRDRDKMAKFQRNQREDTRRGARPLSIKPGDTVLVRNQKADKTDSSYKKELHEVLKICGA GRVTVKEKKSGKIYDRNVKHIKKFFMRKAEEGLTSGSSSSEEVAGLVKERQARLIKKPKRLIEY
Derived:
[1] (consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute