Repbase Reports

2004, Volume 4, Issue 4
April 30, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 115

MARINER4_CB

Caenorhabditis briggsae family of DNA transposons - a consensus.

Submitted:
30-Apr-2004
Accepted:
30-Apr-2004
Key Words:
DNA; mariner/Tc1 superfamily; Cb000007; MARINER4_CB
Source:
consensus
Organism:
Caenorhabditis briggsae
Taxonomy:
Eukaryota; Fungi/Metazoa group; Metazoa; Eumetazoa; Bilateria; Pseudocoelomata; Nematoda; Chromadorea; Rhabditida; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis
[2] Authors:
Pavlicek,A. and Jurka,J.
Title:
MARINER4_CB - an active family of autonomous mariner/Tc1-like transposons.
Journal:
Repbase Reports 4:(4) p.115 (2004)
Abstract:
The consensus sequence was reconstructed from the Ensemble genome annotation. Copies are >99% identical to the consensus, many have an intact reading frames (pos. 165-1179) encoding transposase. MARINER4_CB contains 28bp-long TIRs and is flanked by TA target site duplications. Similar to MAR_CE. MARINER4_CB_ORF: 165-1179 (338 aa) MFVPTAIHIRHVLIYLFLSHTTMKDSETFLKNVYNTHAPHYNTIRNWFHRFEKDDFSLDEKDRSGRPREL DLDKLKHALQSDPFQSSRELAVTFGVHHSTVLEGLKSLGMRKLFGRFIPHHLTQANLDRRVDDSITLLTL HAGDRWLDRLITGDEKWVFYDNHHRKSQWVGEGESPQDVPKPDLHPKKVMLSVWWGVDGPIYWELLPEGK TITGDLYTTQLRNLKKAVDRSALKDKKVYYQHDNARPHVSKQVKQELMGYGWNVLPHPPYSPDLAPSDYW LFGDMTRAFEGRSFNSRGAVEAALKQYFASRPAGFYRNGIHKLRERWRHVVDNDGQYN
Derived:
[2] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:
  1. Stein,L.D., Bao,Z., Blasiar,D., Blumenthal,T., Brent,M.R., Chen,N., Chinwalla,A., Clarke,L., Clee,C., Coghlan,A., Coulson,A., D'Eustachio,P., Fitch,D.H., Fulton,L.A., Fulton,R.E., Griffiths-Jones,S., Harris,T.W., Hillier,L.W., Kamath,R., Kuwabara,P.E., Mardis,E.R., Marra,M.A., Miner,T.L., Minx,P., Mullikin,J.C., Plumb,R.W., Rogers,J., Schein,J.E., Sohrmann,M., Spieth,J., Stajich,J.E., Wei,C., Willey,D., Wilson,R.K., Durbin,R. and Waterston,R.H.
    The Genome Sequence of Caenorhabditis briggsae: A Platform for Comparative Genomics.
    PLoS Biol. 1(2), 166-192 (2003)

© 2001-2019 - Genetic Information Research Institute