Repbase Reports

2004, Volume 4, Issue 4
April 30, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 104

Copia2-I_CR

Internal portion of the Copia2_CR retrotransposon.

Submitted:
30-Apr-2004
Accepted:
30-Apr-2004
Key Words:
LTR retrotransposon; copia superfamily; 5-bp TSDs; protease; endonuclease; reverse transcriptase; Copia2-LTR_CR; Copia2-I_CR
Source:
consensus
Organism:
Chlamydomonas reinhardtii
Taxonomy:
Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Volvocales; Chlamydomonadaceae; Chlamydomonas
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Copia2_CR, a family of copia LTR retrotransposons present in the Chlamydomonas reinhardtii genome
Journal:
Repbase Reports 4:(4) p. 104 (2004)
Abstract:
Copia2-I_CR is an internal portion of the Copia2-CR LTR retrotransposon, whose LTR is deposited in Repbase as Copia2-LTR_CR. Copia2-I encodes a 1591 Copia2_CRp polyprotein (pos. 63-4835) composed of the C2HC zinc finger, protease, endonuclease, reverse transcriptase, RNase H. The PBS (pos. 1-14) is complementary to an internal portion of tRNA-Met. Copia2_CRp: MSDTSGKPQTILAEDATNFVSWRRDLSYFLQTKRLHLYLQTPIPPQRALYALEEDQQALGHLGMSCSEGI WDLISGARTTVDAIGIIEGEYRRASDGKLVALDRDRSSFAMLVGERLPAYFQRARRLRDDIRAAGGNWPE SDMRLRLLMGLRSEYHPAKSTAVGMADRSLLALQRMLEDWESLAPQPGGLGEAGYALTARPSGLGSGGSS SNAVGVAARGLPAAGPWGHSRGGGSAGYQGGSSSGGSNEQCWYCFVQGHQRRNCNVRVLDEKAGIFRANI RVPPPPGKGQPGGGGSGGSKGPGGGKGRGRGGKGGGSGKPFTGRGTVLAVQDGGEGAAEGSSDDDPNCNC ADASGDMFGGSSCSVANDGTHHWGVGQAHDSGSSSSTAGYSHAHAGGGSSSSSVSAGLGCAGGCERVGCC GVSGDSTLHLPNSGGSSSVVPGRADGCSAAGVRMPLLPGYSRTDDDGDGSSNSSSRSGGSAACCFTGFPG LGFRRLFKSRYSRDSRGSSCSSSSSAEPASAGGCDVAEDSNGGACYSHTLPPNTSSSSSSSSSRSCRTGF CAPTADGAGDGAATTYQLLVDSGAFRHITAHRHLLSNYTPSRVKMVRWGDGHIGAVQGEGMMSMLSGGQL LHVHNVLHVPTSELSLLSVIALTSNGSKVVFEGDGVQVVRGRRLLLQGRNRNGQYILSNLRLLSTSTEVP IMAPATASTAESSGSSTSNGTSTAAPAGGGGGNGRFAAPTGGGDNSSGAAAPTGGGETDSSAATQEVAGS SSSSRSSSGLSAQVQAALRLHRRLGHLGFSSIKRMVSQGMVTGADVSLSAVRDAAELVCSKCMEAKAASA AFPRSSSGATTVPLQLAHSDVCGPFPHQGRGGAQYYITLLDDATGYGLVRILQQRGQAYTALQEMVAEME SLYPGGSRLRTLRSDNGGEYVSLQLEQWLRSRGTVHQYSAPYTPQQNGAAERVNRTLQDRCRALLLEADL PNGLWPDAVSYAAYIRNLSPSAGRNVTPYEAFTGKKPDVSSLRTFGCRVFVMVPAEQRDKLGARANVGTY LGPERNTAASRVKVGNGMVVSRDLKWDEAIRGPASRRAGTQFGDGVGDSSSNDAAHAAAAPAPGVPAQQT QMGPPPHPSPPSRPATRSQHPNLLPPINPVTAAASAVAGGGSSSSTATAAAAATESDDEEVPPLAPMSDD EDYEPAGCSSATAAVAEPFPGEPQSYEQAQRARDADKWLEAMQEEMASQRENGTWVVEPLPPGTRVLANR WVFKLKPGDETQPPRYKARLVAKGFQQREGIDYDEVFAPTTCSVSLRTLLALAAEQGLLLEQLDVKTAFL NGQLDEELWMQLPQGFEEETASSGNGGAGGDGTEMASNGSGGSSCSARAAQECAGCSKNSSTSVSGNEGG RGGEPIMACRLLKSIYGLKQAPRCWYIKLCEQMGGLGFTPSAADAALFVRHDAEGPVYVLVHVDDMLIAA GSAQQMATVKAAINGCFKVRELGEARVYLGMRIIRRPDGKEIKLSQRAYIEDLLQRHGMVDAKPRSLPLP PGTRVLAAALKDLVLSDSKQYSALVGEMNYLATNTRPDIAFALSLLPVGHA
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute