Repbase Reports

2004, Volume 4, Issue 3
March 31, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 86

GYPSY47-I_AG

GYPSY47-I_AG is an internal portion of retrotransposon GYPSY47_AG - a consensus sequence.

Submitted:
31-Mar-2004
Accepted:
31-Mar-2004
Key Words:
LTR retrotransposon; Gypsy clade; GYPSY lineage; 4-bp TSD gag; AP protease; Reverse Transcriptase; RNase-H; integrase GYPSY47_AG; GYPSY47-LTR_AG; GYPSY47-I_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Tubio,J.M.C., Costas,J.C. and Naveira,H.F.
Title:
GYPSY47_AG, a member of the Gypsy lineage of the Ty3/gypsy group of LTR retrotransposons in Anopheles gambiae.
Journal:
Repbase Reports 4:(3) p. 86 (2004)
Abstract:
GYPSY47_AG is a family of gypsy-like LTR retrotransposons that, according to the aminoacid sequence of its Reverse Transcriptase, RNase and Integrase is phylogenetically grouped with representatives of the GYPSY lineage of other organisms. GYPSY39_AG, GYPSY40_AG, GYPSY41_AG, GYPSY42_AG, GYPSY43_AG, GYPSY44_AG, GYPSY45_AG and GYPSY46_AG are other members of this same lineage in Anopheles gambiae. The GYPSY47-I_AG consensus was reconstructed after multiple alignment of 6 copies. The consensus encodes the 429-aa GYPSY47_AG1p gag-like poliprotein (pos. 640-1926), the 1064?aa GYPSY47_AG2p pol-like poliprotein (pos. 1866-5057) and the 503-aa GYPSY47_AG3p env-like poliprotein (pos. 5061-6569). The sequence of the LTRs flanking GYPSY47-I_AG is deposited as GYPSY47-LTR_AG. GYPSY47_AG1p: MSQQEVVDRILSRLAALEAQQQSIPGVIDYSDPPLHFTKTDGTAVSPESFDKIPDLVKDL PVFSGEPSELNSWIDDVDGIVKLYQTNSTNTVEQQNRFHMVCKFIRRKIRGEANDSLVAS NVGINWNLIKKTLITYYGEKRDLETLDFQIMSVQQKGRSLEVYYDEVNRLLSLIANQIHT DDRFSHPEASKALIETYNRKAIDSFIRGLDGDVYKFIRNYEPTSLAAAYSYCISFQNIEC RKMLTTPKSYIPPSAPRNLIPIVPRIPTKPNMYRPPTTPNHPNSPIYYRPPTYLTPQNRP NQNFYNPHLRIRPPVIPQRNPFKPPVAQNPPQPEPMEVDSSIRSKQVNYGNRPNFSGTYK PPLKRTRAFNIETNTGNEQVEYEEEMAKTLEECDDDVLSAHDRYLACINRQDGSETSENG EEAELNFLE GYPSY47_AG2p: QTRWIRNIRKWRRSRIEFFRMSSTLPYFLYYGNAKEPLRILVDTGSNKNYIHPKYAKISH DLEKPFFISTVAGDVKITKYSQARLLKPYSDKMIKFFHLEQLKSFDAILGWDSLKENGSW INTVQDTLIVNGKYTIPLLLYKLQEVNQINIRDEHLQTQEKNDLRNMLHDFQDIFQPPDK KLPFTTKVKAEIRTIDQSPVYSKTYPYPQALKSEVHSQINKLLNDGIIRTSRSPYNSPVW IVPKKLDASNEKKYRLVIDYRKLNSKTISDRYPIPDTASVLANLGSNKYFTTLDLASGFH RIPMHERDIEKTAFSINNGKYEFVRMPFGLKNAPSIFQRVMDDTLREHIGKICYVYIDDI VVFGKTVEEHLKNLKTVLETLREANFKIQPDKSEFLKSEVEFLGFIISAEGLKPNMKKVE CIRKYPEPKTLKDLRAFLGLSGYYRRFVKNYAELAKPLTKLLRGEDGHRQIPKNQSKNFT ITLDESAKKSFQYLKEVLCSNDVLAFPDFEKPFILTTDASNIALGAVLSQQTSDGERPIT FISRTLSRTEENYATNEKEMLAVVWALQTLRNFIYGAKLKIFTDHLPLTFTLSPKNNNAK LKRWKSFLEEHDYELCYKPGKANIVADALSRVQINSLTPTQHSAEDDDNDYILSTEAPIN VFRNQLIFRLTPNSSYELTIPFQGYKRHTFCESEFSSDFIKQTFKKFLNPKVRNGIYCDQ SIMGNIQEIFKSMYNSKVIKIRYSQLKVEDLQTEEQQLEKIKEIHNFAHRNVKENSIQFI KKYYFPGMRKSIQNFIQNCEICKLEKYDRKPQKFIPIKTPIPTYPGEIVHIDIFAYNANN LFITSLDKFSKYLKIRPIKSKSIADIKDVLLQLLYDWNLPAEIVIDNESSFVSNVVEQSI LNLGVKIFKTPVNRSETNGQVERCHSTIREIARCIKSLNPDMSITCLVQQATYKYNNSIH SFIKDTPRNIYIGEFSNDHSFAERSKIREEKDRKIAQLFKEKEEKIVDQEYQTYEPGSIA YEKNKTNNKRESRYYPIKIKENHSTYIIDSNNRKVHKVNLRKTN GYPSY47_AG3p: QKNLLTFNIFSLFRLAICVSFTIVYANIGIHDITNNPLAVIPLGQARVKTGNIRIIHPIK IDHLEQVLINNDAELKHHVNDNPLYNIIKLKVNKLHETFNKIRPHTNRERRWDTIGTIWK WIAGTPDAEDLRVINSTINSLIEQNNQQVLINDEIDKRLYDITRIANSVLQLEEERFHQR SNEIIQLIIISNLDTLQNYLETLEDAILLAKHGIPSSKLLSLDDLNQMVMFLAEHNIHVS STEEMLIRSTAQVTMNKTHIIYMLKYPFESKHTFEYNYIDSIIKNDKRILLHHNYILKNN THVFESSQPCEQIDNGNYLCDSILLEPSSKCIQKLVHGYHSDCTYEKVYSDGIIKRIHDA VILINNATVRISSSCNNDTQFLTGSYIIHFEKCNIYINGEEFPNLEITIPNKAFQPTLGL IATETDVIDIPPSKYLNNLTIEHREILKKIKLENKSLSWKVNLFGSISGSIVFIVFIVIA VLINIYRYQSLRFILPSASRETT
Derived:
[1] (consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute