Repbase Reports

2004, Volume 4, Issue 3
March 31, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 82

GYPSY45-I_AG

GYPSY45-I_AG is an internal portion of retrotransposon GYPSY45_AG - a consensus sequence.

Submitted:
31-Mar-2004
Accepted:
31-Mar-2004
Key Words:
LTR retrotransposon; Gypsy clade; GYPSY lineage; 4-bp TSD gag; AP protease; Reverse Transcriptase; RNase-H; integrase GYPSY45_AG; GYPSY45-LTR_AG; GYPSY45-I_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Tubio,J.M.C., Costas,J.C. and Naveira,H.F.
Title:
GYPSY45_AG, a member of the Gypsy lineage of the Ty3/gypsy group of LTR retrotransposons in Anopheles gambiae.
Journal:
Repbase Reports 4:(3) p. 82 (2004)
Abstract:
GYPSY45_AG is a family of gypsy-like LTR retrotransposons that, according to the aminoacid sequence of its Reverse Transcriptase, RNase and Integrase is phylogenetically grouped with representatives of the GYPSY lineage of other organisms. GYPSY39_AG, GYPSY40_AG, GYPSY41_AG, GYPSY42_AG, GYPSY43_AG, GYPSY44_AG, GYPSY46_AG and GYPSY47_AG are other members of this same lineage in Anopheles gambiae. The GYPSY45-I_AG consensus was reconstructed after multiple alignment of 4 copies. The consensus encodes the 351-aa GYPSY45_AG1p gag-like poliprotein (pos. 278-1330) and the 1054?aa GYPSY45_AG2p pol-like poliprotein (pos. 1273-4434). The sequence of the LTRs flanking GYPSY45-I_AG is deposited as GYPSY45-LTR_AG. GYPSY45_AG1p: MTTETNVPNIYELGKVPDFVKDLREFDGRHTELMNWIADVEEILTLCVSCKISQLLGTLV QRTIRRKIVGEAAEVLNTNNISTDWKEIKEVLLLHYGDKRDLFTLDFELSTMRKSNGESL TAYYGRVKETLALIIAHVQTNEKYREHAPIHTQFFNEKALHSFIRGLDKPLSFILKTSAP ANLSKAYQLCQEYYSTDLRFARMFEPRGQADFNQKPVPKPRGSFNPMPYPRASTSFVPST ASHSVPNTTHTIKSNRYQTPTPMEVDGSIRYDNGSHSRRFTQQTYPRVPSTQVKDFKRQA NTVHDDTDRKINNTGLESDYQHQQSEYEAGHDHNLDGSLYQNHFLEWDPKW GYPSY45_AG2p: SQFGRLFISEPFFRVGSQMVKPILPFVKLKTNIGEFPFLIDTGANVSLIDPKLANSCKIG KPYDLCDRNIASASGKFITSSAIDINFFSPKIDQICTFLLHSFHSFFFGIIGTDILKCLH AVIDLETDNLILKKNSQVLHIPLFSYSSSKTTLNPIFRLEHLNCNEQAKLKKILDANNSV FHEPKLQLTCSTRVECAINTNDDIPIHQKVYPYPAAYTQEVNNQIKTLLDNGIIRPSHSA WTAPVWIVPKKIDASGEKKFRMVVDYRKLNQKTIADRYPMPEINYVIDQLKGHQYFTTLD LASGFYQIRMRPCDIEKTAFSINNGKYEFLRMPFGLKNGPAIFQRVIDDVLRSEIGKTCY VYMDDVIVFGKSFEEHLNNLNNILQLLSNANLKVQIDKSEFLHDKIEFLGYIITSEGIKP NYKKIEAISRYPEPSNIKELRGFLGMMGYYRRFIKDFARIAKPLTNLLRGDENKASKKKI DLSIAEKACFQKLKSIISSEDILIYPDYSKPFLLTTDASDIAIGAVLSQGQIGKDRPIHF ASRSLSKTEEKYSVPEKEMLAIFWALKIFRNYLYGTKFTVLTDHQPLTFALSAKNTNAKL KRWKSYLEEHDFEIAYKPGNTNVVADALSRNVCSLTGTQHSAETSDDFFIISTETPLNAF KHQVIIKNGCDNVQRRQIFSSHNRITISLNDTNEISLLQVLKKYFDPSKINGLFTSEAIM GKIQEVYRKYFGNTNLLKIRYTQKLVRDIEDEEEQWQIAKTEHVRAHRCAEENTQQILRN FYFPKIRAKSKQIAKECQTCHENKYNRKPIDYPIQKTPIPSNPFEIAHIDILFLENNYFL TYIDKFSKFAQIKLIESRATIDILPAVKELTTKFFPPKTLVMDGEKSFCSRELELFYKAY NIETYVTATGRSEMNGIIERFHSTLLEIYRITKKENPTFCTPDLVELSVQKYNSSIHSVT KHTPIEVILPSVRSSEIINNVHKNLIQKQSQDLIFHNKNKKSVPIDINNDTYEKTRARLK HKPRYKKKNIMNINNSTVLLEGNRKVHKNDLKIR
Derived:
[1] (consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute