Repbase Reports

2004, Volume 4, Issue 3
March 31, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 54

GYPSY31-I_AG

GYPSY31-I_AG is an internal portion of retrotransposon GYPSY31_AG - a consensus sequence.

Submitted:
31-Mar-2004
Accepted:
31-Mar-2004
Key Words:
LTR retrotransposon; Gypsy clade; MDG3 lineage; 4-bp TSD gag; AP protease; Reverse Transcriptase; RNase-H; integrase GYPSY31_AG; GYPSY31-LTR_AG; GYPSY31-I_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Tubio,J.M.C., Costas,J.C. and Naveira,H.F.
Title:
GYPSY31_AG, a member of the MDG3 lineage of the Ty3/gypsy group of LTR retrotransposons in Anopheles gambiae.
Journal:
Repbase Reports 4:(3) p. 54 (2004)
Abstract:
GYPSY31_AG is a family of gypsy-like LTR retrotransposons that, according to the aminoacid sequence of its Reverse Transcriptase, is phylogenetically grouped with representatives of the MDG3 lineage of other organisms. GYPSY29_AG, GYPSY30_AG, GYPSY32_AG, GYPSY33_AG, GYPSY34_AG, GYPSY35_AG, GYPSY36_AG, GYPSY37_AG and GYPSY38_AG are other members of this same lineage in Anopheles gambiae. The GYPSY31-I_AG consensus was reconstructed after multiple alignment of 3 copies. The consensus encodes the 1511-aa GYPSY31_AGp gag-pol like poliprotein (pos. 28-4560). The sequence of the LTRs flanking GYPSY31-I_AG is deposited as GYPSY31-LTR_AG. GYPSY31_AGp: MSKEDGKVLRELESVSCPNSEPATIGKIRALYNDVLSITNTIESECIDQGDVDPKPTYSV TKEEASSAKPMHLSNHVEDEIAILKQRLEILELRSKIAVLENEKQASKINQPLLPEALKQ IIPQFEDGVGVNHWLKVIDHSSEMYGWDDNTTMLYASSRLVGAAKEWYNGCRSEICTLSE FTAGLKRAFPDNRNEAAIHKELMSVAKRRDETYTAFIYRVNAIGKSGNVSDEAILTYIIN GLARDRIYDNLVVRDYKDIYELMAHIQRCETLLKMRDTPSTSSYQRLENTRVNENQREKP NRAAQINRKDALASVRCYNCSSFGHYSGQCLKPRRTIGACFSCGQHDHQKLECANAAGKN NIPVFATNETTSERDSYADIEKIKAYQQVSVSLETLNGVKKFHSYVYSLFDSGSPTSFIS ETFVPDGAAKKASPSGYKGLGNKPLSSLGHIVCNIGFRHKIISHRFIILSKSDMDWPIII GRDALDKLNVHLYHSFYLYSKEKLLSLNNKTMNYLKPHMMERLISLGVLKNDSDDRLKRK MPLIKAIEENKYNLKEIPFHSLNHAILESSLSNRKKDDNSNQSFISDEFKYGETFAEMCA IDVNLPEHDFNIGSIVGIRERKQISSIIIDNYIKRQTGKIYKENHKMTISLTHDTPIFCK PRKLSFAERNHVREIVKDLLQRKIIRQSNSAYASPIVLVKKKNGETRMCIDYRPINKITV RDNYPLPLIDTCIEHLGDKQYFTLLDLKNGFHQIDMAPASIKYTAFVTPDGQYEYVKMPF GLKNAPSEFQRCINSVLREFIDNREIVVYLDDIIIASKDLHNHLRILSAVLQTIRKNGLE LKLEKCMFVHDELDYLGYHASSKGIRPSNYHIKAIENYPQPSNSKEVQRCLGLFSYFRRF VPSFSTIAKPLSSLLKQNAPYNFDGPCISAFNTLKEMLIKAPVLAIYDPQKETELHCDAS SVGFGSVLLQKQFDGKFHPIAFFSKTASPAEAKLHSYELETLSVIYALKRFHTYVHGVPI RIVTDCNSLVETLKNKNCSAKIARWSLFLENYDYTMQYRPGCSMGHVDALSRQQIAVATQ DLDIDSQLRIAQSRDQEIERLKSVIERGMVNGYTLHDNLVFRKLENGRLQFRVPRDMINN VIRSTHESIGHLGVDKCCTQISKNYWFPLMKTRVENFIKNCLKCIIYSAPARKNNRNLHS IPKIPLPFDTIHIDHLGPLPSLQSKKKYILVVIDAFTKFTKLYPTTNTSSREVCNALNQY FSYFSRPRRLISDRASSFTSTEFKQFILKHNITHVLTAVCSPQANGQVERVNRVIVPILS KLSDPIDHADWSSKLIAAEYALNNTVHSSTRISPSVLLYGIEQKGPNINELTEYLKDNIP TTPRDLESIRVQASENIVNSQFTNETQFMKTHRPAIEFEVGEYVVIRNVDNSVNTNKKLI AKFRGPYVIHKRLPNDRYVVRDIEGFQQTQIPYDGVLESDKLRRWIASETDLASESLEVS PSDSLAGPDLG
Derived:
[1] (consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute