Repbase Reports

2004, Volume 4, Issue 2
February 29, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 40

L1-2_CR

L1-2_CR is a L1-like non-LTR retrotransposon - a consensus.

Submitted:
29-Feb-2004
Accepted:
29-Feb-2004
Key Words:
non-LTR retrotransposon; endonuclease; reverse transcriptase; L1 superfamily; L1-2_CR
Source:
consensus
Organism:
Chlamydomonas reinhardtii
Taxonomy:
Eukaryota; Plantae; Thallobionta; Chlorophycota; Chlorophyceae; Volvocales; Chlamydomonadaceae
[2] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
L1-2_CR, a family of L1-like non-LTR retrotransposons from the green algae genome.
Journal:
Repbase Reports 4:(2) p. 40 (2004)
Abstract:
Several hundred copies of L1-2_CR are present in the C. reinhardtii genome. They are ~98% identical to the consensus sequence and constitute ~0.5% of the genome. Since some elements are identical to each other, the genome harbors currently active L1-2_CR elements. The consensus is incomplete at the 5' end. The reconstructed portion encodes the 1439-aa L1-2_CRp protein (pos. 639-4955) composed of the endonuclease and reverse transcriptase domains. L1-2_CRp: MRRPKQAAPGPRPLRVGSHNVRGLRKRVPHLGCSRLHALLSCWERQRLDVVCLQETHVLDSDIDLVTADL AAAAQRLHAREWTAWWAPAQKPEGRRVTGGTAILIRSSLLQQGAMVLAGGAAAVSVAAGAWAGRGVSLQL QWGGHTFTLTSAYFPLASTAQQAFIREWVGLRASGSGEHLLAADFNFVADVALDTVTGRARSDGPAAAAL AAACPGLIDVLRRRHPARRVCTFFHPHGASRLDRILCSGGLEPQVLECGVAAGVPSDHMLVTVALAASPE AAPPARSLPRAHLGFRDFKDLDRDYRAWLGTALAARPTDPVELLEWWPALKRAAATSANRLSREAVTRRV AASQREAAALEAAAAAAAAVEAGGDVQVAAQAAVRARCTAAEAAVAAAAGAARRTRHAWLRGGEKPCPLL TRMLRPAGGPRVIAKLKQPDGTTTSDPTVMGQVMARYWRDVSAAPPPAPDARTQVLDALQQHGRRCTAEE ADQLGRVAVSAAEVRAALAAAPAGRAAGPDGIPVELYQHYDSDFAPVLADVFTAVGEGAGVPDGLLDGVW SFFFKSGDPTEPSNYRPITLTDTDYRTLARVLCLRLQPVFGRVIDPEQTAFLTDRRIADNVLLLQLTPGL LKAAKKAPAVAAFLDFYKAYDTVDRSFLLACLERMGVGAGFLTWVSRLLTDTRGAALVNGRVSGWVPLMA GVRQGCPLAPLLYLAVAQALLSWLRSRGHGVLANLASVLASQYADDCTPFLEGFQAVPGFLADMDVFRRA SGQRLNMTKVELMVMGTVGGAGALPAGMAGPPLPPGWRVVPAAKSLGVHYGDWGACSPPVTFEAVMGVLS KIARMPVSMFGRAAAASAYALGKVLYHLEFAGLPQLYVVDRLLARVAAVVDRRLSPAQFDANPHARPAGL SIELMQLPPAVGGAGLLPLVPHVKARQAGLAVRCVLGVCGLLPYVPPWTRVAAAWLRQVHPAATPLRLLV RGAADRVLNKPLTPAGKPFARLLKAMTALPAVTLVAPPEPGAWVSHVPLWANPALCEDGRTWEVAFADLF ALPGLACVGQLVAAHDGLNELRQALTRPWAEGSRSGEACADMYVTAVWRRVLHWSTRARLPSPLPGPASP QEAADRFAAAVALLPAGWAAAARAAQLARGPAAALPLPVADVVSATAESVQRVVRGLGWLQCGGPPILLT AYTVKAGTVLQMAPQLAALKAKHLQYVCDAGVSGVGAALAAGAFVCTLARLWSLKWENHHKEALWRVAAN ACWAFPRHASERARGVTVDPCWACGVDMQDGDRRHWFWDCTVALSLRESMGMAMGFLPEEALSAFSREEL WLVRPPAGLAPPVWDVVCLAAMSALDFGRQRVVMAGLAARAKLPSARVLSIGLAVVADFWGRLQTFVTLG IRPKGWDAVPFAHPFISRAVGDGMVLRLPYDADSPPPSP A subset of more than ten L1-2_CR elements is characterized by a remarkable target site specificity. They are inserted in different copies of the DNA-2-7_CR transposon at the same site (position 593 in the DNA-2-7_CR consensus sequence; usually the 593-601 region of DNA-2-7_CR is duplicated around the L1-2_CR inserts). The DNA-2-7_CR sequences that harbor the L1-2_CR elements are less identical to each other than the L1-2_CR sequences. Therefore, the L1-2_CR and DNA-2-7 elements cannot be different parts of the same composite transposon.
Derived:
[2] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:
  1. Day,A. and Rochaix,J.D.
    Characterization of transcribed dispersed repetitive DNAs in the nuclear genome of the green alga Chlamydomonas reinhardtii
    Curr. Genet. 16 (3), 165-176 (1989)

© 2001-2020 - Genetic Information Research Institute