Repbase Reports

2004, Volume 4, Issue 2
February 29, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 35

Gypsy-1-I_CR

Gypsy-1-I_CR is an internal portion of Gypsy-1_CR LTR retrotransposon - a consensus.

Submitted:
29-Feb-2004
Accepted:
29-Feb-2004
Key Words:
LTR retrotransposon; Gypsy superfamily; gag; protease; reverse transcriptase; endonuclease; chromo domain; 5-bp TSDs; Gypsy-1-LTR_CR; Gypsy-1-I_CR
Source:
consensus
Organism:
Chlamydomonas reinhardtii
Taxonomy:
Eukaryota; Plantae; Thallobionta; Chlorophycota; Chlorophyceae; Volvocales; Chlamydomonadaceae
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Gypsy-1_CR, a family of gypsy LTR retrotransposons from the green algae genome.
Journal:
Repbase Reports 4:(2) p. 35 (2004)
Abstract:
Gypsy-1_CR can be still active retroelement. It is flanked by identical LTRs. The internal portion encodes the 778-aa Gypsy-1_CR1p (pos. 37-2370) and 1331-aa Gypsy-1_CR2p (pos. 2664-6656) proteins. Gypsy-1_CR1p includes the gag-like domain. Gypsy-1_CR2p is composed of the protease, reverse transcriptase, endonuclease, and chromo domains. Gypsy-1_CR1p: MGQKSGGSAPPATKQKSAGATRTTHGKPTGATTAAGKRASDQTSDHVKSRRAIAQGAEMGAAKDTSDVMD DANVVSGGSPAGSGKRRIPGQHGSNQGSPGQGHRDSNGDTVMGEVVGPGAGGTRAGAAGTQPPASTLPPS ALNATDRRKRLMAAYLAAYARVNGHVQHYTRAAQPIVTADDVVRAHELATVMGTSLTLTNQTMLDYILDV AQNEALPPVPTTAGAPADAPAGPMPAGGGNRAVLPTAVTPMDPVMAEIKQSLTRLDTALTDLKLQAQHDR KELEDLIALNAPPPAPATDTDLTNTASADSSSTSESEPSEAVDDEPSEVEPPAAEPPVQAAAPAADAPPP IRLLAFGAKPAAAKTAPTSTDQHRRRRQKYVSLGVSRFRQSPQYVPLRDDLYRHQNRASIKAFTKAFVKS VDAYLTAKRLDKMQALDELRAYEAMDIEMPLQYLRGENAEKLTENDRRRFYTQRITAPPTYAAAAAAAPS TIDEVIAQRDQVGTGGTGKKPKVPEPQKFSGVTDKHITCTTTWFDTFVEYCDEQKLEPSRHLLFFCTGTA QEWMVGYRHDMQLAKMAITTSRLRTAFLQQFGDVRRHTPAEARRRLMMLEHKQQPGERIATYTQRFRLIA RDARDMAELDRIEHYMNGLAAQFQAVCRTDSEGKDWTSLDSLVSYALGQESRKTQSKGATLAIANTSRPP FRSRPRKQGCSTGGGGGGGGGGYGGKRPGGGARDSGKPKKIRADRNTCRHCFEHFANGFPAQHLQDCAVL KRKKAMAA Gypsy-1_CR2p: MRSFCLSVTFIPRIGCGGRNPLVSRAVRAVDSIRGSLPHVQERKPTDTSAVFVAPQWPELEQYFTKSGFR LLKSYPTGTQLFTIAGSNLTTLAAPWPVQLWYDPPEPDAKLSAIAPKVSYTMTFRGRAGHTDVTTLVDSG ACTVGTADGYISQKAATQMGLRATSSPTPAVTLADGTRKALGGVVQTRLQMGAYHGTVHLLVLPDTVTGA QIILGTDWLNRHGALMDWESHTLTLRRGHKRVALRPAYTESPDMLAGSVYADPMQVMDYVRALLHDASTP RNLISKNEFARCVTTYGEHAFLAVVRWPDPTDEAWTPTCALAAATLPTLGDTGLIPAHDLQNLLTEHADV FEELKGIRKDTTGISHTIPLVEGAHPPSKRMYRLSQGETTEVNKQVADLLAKGFIEPSNSPFGAPVLFVQ KKDGTLRMCLDFRALNKLTVKRNYPMPNIQDLFDQLEGAKVFSSLDLQSGYYQIPITKEDQEKTAFITPK GQYQFKVLCFGLTNAPASFQATMSKIFKKQLGKTVLVYLDDILVFSKTPEEHLAHLREVLGVLREHEFKA KLPKCDFNKSELKFLGHIVGRHGVRVDEDKVKVVKDWATPTNLKQLRSFLGLANYFRRFIQGYSSLVAPL MALTGTKVPFVWTPECQAAFEGVKVALTSAPVLALPRFDLPFEVWSDASIYGTGAVLLQDGKPVAYTSAK FSSAEHNYTTTDQECLGVIHALTEWRCYLDGASHVTLVTDHQPLTYLQDQKSSNLLSRRQARWMEFLSRF SFTWEYRPGRINVADPISRIWEPMCAALTRSEISSDLLDRIRKGYSGDSLFSDSRASASLQLKTSAGLWY RDTQVVIPAADGLRELILTEFHNSPTAGHRGARRLKEAISRRYWWPRLDADCTEYVASCPDCQRNKPSNQ KPAGKLQPLPIPEANWDSVSLDLITKLPTTLAGHDAIVVFVDRLSKMTHFAPTHSDVDAEELAEIFLQYV FRHHGLPINLVSDRGSVFTGRFWKELFSRLQTKLHFSTAYHPQTDGQTERMNRLLEETLRHYIGPLQDDW DKHLPLIEFAINNSQSGSTGATPFELNYGRRPRVPGDLALPSSNVPAAQNFSDAMRQRMAHAKKCLRAAQ DRQRVATDSCRRDSKFDVGDDVLLSTKNIKLRIPGAAKLMPRYIGPFKIQRRIGAVAYELALPPGYKIHN VFHVSLLKAWKPGQAYNPPPAILEDNGDTYWSVESLLLHRDRKCGRKTLREFLVKWEGYGPEHNSWEPEA NLRESAPLEEAIEEYLARTATKQAAREKRINTVAQRRADRKAAATQRYATRKATPPAAPTKAPRQTRGRA T
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute