Repbase Reports

2004, Volume 4, Issue 12
December 31, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 313

Gypsy10-I_DR

An internal portions of the Gypsy10_DR LTR retrotransposon - a consensus sequence.

Submitted:
00-Dec-2004
Accepted:
31-Dec-2004
Key Words:
LTR retrotransposon; endogenous retrovirus; Gypsy superfamily; gag; reverse transcriptase; integrase; Gypsy10_DR; Gypsy10-LTR_DR; Gypsy10-I_DR
Source:
Danio rerio
Organism:
Danio rerio
Taxonomy:
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Cyprinidae; Danio
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Gypsy10_DR, an LTR retrotransposon from zebrafish
Journal:
Repbase Reports 4:(12) p.313 (2004)
Abstract:
Gypsy10-I_DR is an internal portion of the Gypsy10_DR LTR retrotransposon that belongs to the Gypsy superfamily. Its long terminal repeat is deposited in Repbase as Gypsy10-LTR_DR. Gypsy10_DR is characterized by 4-bp target site duplications. The internal portion encodes one 1988-aa polyprotein composed of gag, protease, reverse transcriptase, and integrase domains (pos. 142-6105). Gypsy10-I_DR1p: MSFRSDPQLQSELLEWCREAVIDPAHALLLTGVPQNTETACIEKVAESVKLFGRVRVRDSKGGA TPTTLLVLCECREVVDPTNCPEELHPTDGEEAWMIILATERESAHVAPAEFADKLSKFLKDEGK SMTDVHALFSPQSANPSSPESIIRAVGEILEKTVRPSSDGSAYRRLRTFSGIVPTPVGEETMDH WIEQAKLMISECECSEKEKRRRIVESLKGPALEIIKAVRMSCPDAEAVKYVEALESTFGSSESG EDLYFAFRLLRQCPGESLSAFLRRMEKSLTKVIQKGGLTSANADKARVEQLIRGAVESDMMLLQ LRLRERKENPPTFLSLLNEVREAEEIEATRRKITATAKPIHLQEESICPTVVHELKAEIQELRA QIKSDRSNIASSMMIENRVKSRQLSPTDSKEVVKETEVQVLKKQVQQLQQQLAIMSVGQSNSTS HAQLPQTPVSSSSRHQLSKPKADYFCYRCGEEGHIATKCKAPENATLVINKLVRSLKRAKGTKS DPNSHAEDRACFSKKSQIHSCESKGLPKGLVGPASTIAVKVGGHPCCALWDSGSQVTIVFDSWY SEHLSNVPILPLSGLSIWGLSSSNYPYKGYIVVDVTFPVALTGAEETVTILALVCPDPKGPQQF PLIIGTNASFFQRMTNGEGTNITRSAHSLRIQTHLDTTSFAVDQPEGQVRWKGPGMLNVPSQGE RYASCKIESDKPLRKDIFLIETSPVDSLPAGLLVSPVVFSSSAVDVNNFRILIQNETSKELSVP PGTVVAQIFPTDTVTVAHGVTESNDQINPDVFNFGDSNIPTAWEKRLRLKLAERKNVFSTQEWD VGLAKGVTHQIRLHDPHPFRERSRRIAPADIDDVRRHLKDLLAAGIIEESRSPYASPIVIVRKK SGAVRMCIDYRTLNSRTTPDQYVTPRIDDALDCLAGSKWFSVLDLRSGYYQIAMSEEDKEKTAF ICPLGFYQFQRMPQGITGAPATFQRLMEKVVGDMHLLQVIVYLDDLIVFGSTLEEHEERLMKVL DRLEEWGLKVSIDKCQFCQPKVKYVGHIVSAAGIAPDPEKVAAVTQWKEPTDLKSLRSFLGFCG FYRRFVKNYSSIVRPLTELTKGYPPAKGKSKVEGKKYFKETDQFGERWDNACKQAFQEIIKCLT QAPVLAFADPSLPYVLHIDASLSGIGAVLNQEHSDGLRPVAFASRKLSASEQRYHIHQLEFLAL KWAVVDKFHDYLYGVPFVVRTDNNPLTYVLTSAKLNATGHRWLAALATYNFSLQYKPGKHNIDA DVLSRYPAEPATSFSWTEIPQSGVKAICQLSNLSWSDEKSRLIDQLGVSPGSIPAVYSCPALLD VCHLEQLTHADLKLSQEQDPVIGKVKQDIARNKPLTPIKGSDPTLTLLQRQGPKLVIRNNLLYR VTKNQSGKEKVQLVLPEKYHLTVLRSLHDDSGHLGVEKTTELLRDRFYWPRMTSDIEQYIKNCG RCITRKTLPQKSAPLSHITSSGPLDLVCIDFLSLEPDSKGIANVLVITDHFTRYAQAFPTKDQR AVTVAKVLVEKFFVHYGLPSRIHSDQGRDFESRLIQELLGMLGIRKSRTTPYHPQGDPQPERFN RTLLSMLGTLEPAQKSKWSQHITQLVHAYNCTKNEATGYSPYQLLFGREARLPIDICFGISPAG EKGVTHLQYVEKMKAELQQAYQLAAETSLKAHQRNKKLYDTRVKPQLLTVGDRVLIRNLAVKGK NKLQDRWNSLPYVVVEKFKDLPVYKLRPERGMGAIRTMHRDHLLPVGENVRFSKPNDSNPSTQS PVTRAQSGKRVQKEKKVENVEQVRDENHETSESEDDNLCYYYPKLIPALRTLPTPQIAVEPEIP AEYGPELNSECEARKDTVEEEAREVLNQPAEAVDDQGVGDNDHRNVPKPGSEPAVCRKSTREVK PVIKLSYDDLGRPTDKPLTMVHRGMVVHIEDLSKTRKSCNTVWCHPMAQCSQCVPTAPGPIVRT VIQF
Derived:
[1] (consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute