Repbase Reports

2004, Volume 4, Issue 11
November 30, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 305

hAT-2_DR

hAT-2_DR is an autonomous DNA transposon - a consensus sequence.

Submitted:
00-Nov-2004
Accepted:
30-Nov-2004
Key Words:
DNA transposon; hAT superfamily; transposase; hAT-2_DR
Source:
Danio rerio
Organism:
Danio rerio
Taxonomy:
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Cyprinidae; Danio
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
hAT-2_DR autonomous DNA transposon from zebrafish
Journal:
Repbase Reports 4:(11) p.305 (2004)
Abstract:
hAT-2_DR is an autonomous DNA transposon. This transposon is characterized by the 8-bp target site duplications and 16-bp terminal inverted repeats. The consensus encodes the 611-aa hAT transposase (pos. 255-2087). The genome contains about 1000 copies of hAT-2_DR nonautonomous elements that are ~97% identical to the consensus. Nearly all these copies are nonautonomous elements. The transposase-encoding elements are present just in 2 copies. hAT-2_DRp: MPANTMDRFLRPPDSKPSSSGLKPKRRRYDDQYLSLGFTWTGPADEPRPLCVVCQDILANDSMR PAKLRRHLETKHDEVAGKPPEFFKRKLQTLQGQKKIVEDFVKLNGKATEASYRVALRIAKAGKA HTTGETLILPAAKDICSVMLGEAAASKIDSVPLSDNTISRRISDMAQDVKEQVLDGVRHSPFYA LQIDESTDVASCAQLLTYVRYVKNMDIHEEFLFSSPLPAHTTGEQIFNQLNEFVRKNDVEWERC CGICSDGAKSMTGRYSGLMSRVKEVAPNAIWTHCTIHRQALAAKKMPNDLRSVLDEAVKIINLI KARPLNARLFHILCDELGAHYKQLLLHTEVRWLSRGRVLSRLLDLREEVLLFLSNVQSTLVQHM SDLSWIARLAYLSDIFERLNALNLSLQGRDCNVFSAFEQVSSFRRKLDLWATRVEKGCLDMFPT LADFMQEAGSVVHIQPLVAEHLRGLCQQFTHYFSNETILDEWIRNPFKFKPAESDVLSIQDEEA LIDLTSNHELQQMITHSSIEHFWLSVQNEFPELTQKALRKLLPFVSTYLCEPEFSALTFIKNKY RSRLQVEDDLRLFLTSLQPRISLLCAARKQLHTTH
Derived:
[1] (consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute