Repbase Reports |
|---|
| 2004, Volume 4, Issue 11 |
| November 30, 2004 |
| Copyright © 2001-2016 - Genetic Information Research Institute |
| ISSN# 1534-830X |
| Page 303 |
Tc1-1_DR |
|||
|---|---|---|---|
Tc1-1_DR, an ancient Tc1 transposon reconstructed from its deffective copies present in the zebrafish genome. |
|||
|
Submitted: 00-Nov-2004 |
Accepted: 30-Nov-2004 |
||
|
Key Words: DNA transposon; Tc1/Mariner superfamily; transposase; Tc1; Prince; TXr; Tc1-1_DR |
|||
|
Source: Danio rerio |
Organism: Danio rerio |
Taxonomy: Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Cyprinidae; Danio |
|
| [1] |
Authors: Kapitonov,V.V. and Jurka,J. |
||
|
Title: Tc1-1_DR, an ancient family of Tc1 transposons identified in zebrafish genome |
|||
|
Journal: Repbase Reports 4:(11) p.303 (2004) |
|||
Abstract: Tc1-1_DR is an ancient family of Tc1 transposons that was active in the zebrafish genome more than 10 million years ago. The zebrafish genome harbors several thousand copies of Tc1-1_DR elements that are ~85% identical to their consensus sequences; all copies are severely damaged by mutations. The Tc1-1_DR consensus sequence encodes the 340-aa Tc1-1_DRp transposase (pos. 376-1395). Tc1-1_DR elements are characterized by the TA target site duplications and 210-bp terminal inverted repeats. The Tc1-1_DR consensus sequence is ~90% identical to Tc1 elements present in frogs (TXr from Xenopus laevis, Prince from Rana pipiens). Presumably, independent multiple events of horizontal transfer were involved in evolution of these transposons in vertebrates. Tc1-1_DRp: MPRSKEIQKQMRKKIIEIYQSGKGYKAISKALGLQRTTVRAIIYKWQKHGTVENLPRSGRPTKI TPRAQRQLIQEVTKDPTTTSKELQASLASVKVSVHDSTIRKRLGKNGLHGRVPRRKPLLSKKNI KARLSFARKHLDDPQDFWENTLWTDETKVELFGRCVSHYVWRKSNTAFQKKNIIPTVKCGGGSV MVWGCFAASGPGRLAVINGTMNSAVYQNILKENVRPSVSDLKLKRTWVLQQDNDPKHTSKSTSE WLKKNKMKTLEWPSQSPDLNPIEMLWHDLKKTVHAQKPSNVAELQQFCKDEWAKIPPQRCNRLI ASYRKCLIAVVAAKGGPTSY
|
|||
|
Derived: [1] (consensus) |
|||
|
Download Sequence - Format: IG, EMBL, FASTA |
|||
|
References: |
|||