Repbase Reports

2004, Volume 4, Issue 11
November 30, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 294


Caenorhabditis briggsae family of DNA transposons - a consensus.

Key Words:
DNA; mariner/Tc1 superfamily; transposase; 3bp TSD; Cb000088; MARINER45_CB
Caenorhabditis briggsae
Eukaryota; Fungi/Metazoa group; Metazoa; Eumetazoa; Bilateria; Pseudocoelomata; Nematoda; Chromadorea; Rhabditida; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis
[2] Authors:
Pavlicek,A. and Jurka,J.
MARINER45_CB - a family of autonomous mariner/Tc1-like transposons.
Repbase Reports 4:(11) p.294 (2004)
The consensus sequence was reconstructed from the Ensembl genome annotation. Copies are 99% identical to the consensus. MARINER45_CB contains 285bp-long TIRs and is flanked by TNA target duplications. C|TNA|G target motif. The family contains two autonomous genomic elements with an intact ORF encoding for a 298 aa transposase, and several nonautonomous copies with deletions in the ORF. MARINER45_CB is related to TC5, TC4 from C. elegans and FOT1_FO from Fusarium oxysporum. MARINER45_CB_ORF: 1060-1954 (298 aa) MELEKEVRMHIENGKILHDSVLRFLIAGIIKKYKIDIENFIGSESWLNGWKARFGITSRKITKFVSTIRH KTRDQIEKDSKEFVTAANQVFPLYHPSNIYNADQSGFQIEMHTARTLTLKGSRNVHCVVGSESSTTHSYT VLPLISASGKLHPKLFVTLKEPKGQFPQKGHFQASNLEVTCHTSHIMTKELMKVFFQKIVFDSSMPKDAL LIVDSWNSWKDTAAIDSVTPSSHKLKLLTIPAGCTGRIQPCDVGIFGSFKKVVKTLTNYAQLTNSNYKFQ TRDETLKVSYLFVKQFKK
[2] (Consensus)
Download Sequence - Format:
  1. Stein,L.D., Bao,Z., Blasiar,D., Blumenthal,T., Brent,M.R., Chen,N., Chinwalla,A., Clarke,L., Clee,C., Coghlan,A., Coulson,A., D'Eustachio,P., Fitch,D.H., Fulton,L.A., Fulton,R.E., Griffiths-Jones,S., Harris,T.W., Hillier,L.W., Kamath,R., Kuwabara,P.E., Mardis,E.R., Marra,M.A., Miner,T.L., Minx,P., Mullikin,J.C., Plumb,R.W., Rogers,J., Schein,J.E., Sohrmann,M., Spieth,J., Stajich,J.E., Wei,C., Willey,D., Wilson,R.K., Durbin,R. and Waterston,R.H.
    The Genome Sequence of Caenorhabditis briggsae: A Platform for Comparative Genomics.
    PLoS Biol. 1(2), 166-192 (2003)

© 2001-2020 - Genetic Information Research Institute