Repbase Reports

2004, Volume 4, Issue 11
November 30, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 289

CR1-5_SP

A family of CR1 non-LTR retrotransposons - a partial consensus sequence.

Submitted:
00-Nov-2004
Accepted:
30-Nov-2004
Key Words:
Non-LTR retrotransposon; CR1 superfamily; CR1-5_SP
Source:
Strongylocentrotus purpuratus
Organism:
Strongylocentrotus purpuratus
Taxonomy:
Eukaryota; Metazoa; Echinodermata; Eleutherozoa; Echinozoa; Echinoidea; Euechinoidea; Echinacea; Echinoida; Strongylocentrotidae; Strongylocentrotus
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
CR1-5_SP, a family of CR1 non-LTR retrotransposons in the sea urchin genome
Journal:
Repbase Reports 4:(11) p.289 (2004)
Abstract:
CR1-5_SP is a family of CR1 non-LTR retrotransposons. The consensus sequence was reconstructed from 10 copies 99% identical to it. The 5' terminus of CR1-5_SP is not known. The consensus encodes the 1047-aa CR1-5_SPp protein (pos. 1-3141) that includes the CR1-like reverse transcriptase domain. The 3' terminus of CR1-5_SP is composed of the (TCTA) microsatellite. CR1-5_SPp: PSQRVNIELCCEITVSADKLAPNMLDNFGIIVVLSVIASLPHFIAESRPALLAGVTMEFQLVQN SIDTERYSDQYRYTKDELLSLRNTSHSRLPDNVFARIKELGIDKRRGCRAGSHKWRKIAVVEGR RRRTPKPPGVRAPQLIPIKTITTVSTDRQSQGNLPTIYMCNPRSLNNKLDEFSVVVHELCCDVC VVTETWFRADQPESDFAVDDYLVFAKSRDSRRGGGVAIYAKPESMPKTVNFLPPHPHHEVIWLQ LRPKRLPRDISCLYVAAVYSPPDNDCVNDLIQYLVNAIDDIKTRHGDAGVVILGDFNRADTSEL TSTCNLRQVVRKATRGTAILDLILTDIHQWYSEPEILSPLGLGGDHNAVLWKPKLNKTNSKNKA VRKFVRPMKDSAIREFGQWISQHTWDDVMASSSAQEKCDKLYASLQNAMDEYLPMKSVKMHPRD KPWVTPYLKSLIGQRQKAFSNDRTEEWKRLRNKVQNKKTELKKNFYKDRVLKLKRENPSSWYKH LKIMTSSKTASNIIIPESPELDDLAIADCVNDHFANVSQDIPELDLQSLPAYLPTPKPQLTVQP HEVYKELNRIKPGKSSGPDGIPARIVKEFAVELASPLCEVLNSSYHSGSVPSQWKGAIIAPIPK EKAASSIDKQRPISLTDHFAKIAEVFIYRKLLADVRHQLDPKQFGARAGRSTTHCLVEIYNFLC KRAELPSNVTSIVSTDFSRAFDRVDHTILIRKLITLEVHPWVIVWICSFLTDRQNQVRYHGELS STRSMTAGVPQGTRLGPLLFLVLIDDALRESEVERWKYVDDMSLASAEPSNQHGQFMQNVLVNL EEWCNQNNVRLNPKKCNIMRVTFSKTPLPDRDFSLCNDVLQEVSAVKLLGVILQRDLKWNDHVS VTISRASSRLYMLRRWKEFHLPAADLVTVYVGFVRPLLEYACPVWHSSLTCAQSAALERIQKRA LRLIFPGTSYNTSLDLARIVDLETRRKTLCINFATKASRSEVGSDWFTENNPTRNLRKNKRYRE PRCRTNRYQNSPIPFMTKLLNFN
Derived:
[1] (consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute