Repbase Reports

2004, Volume 4, Issue 11
November 30, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 287

COPIA-I_MT

Medicago truncatula copia-like retrotransposon COPIA_MT, internal sequence - a consensus.

Submitted:
00-Oct-2004
Accepted:
30-Nov-2004
Key Words:
copia-like retrotransposon; gag-pol domain; COPIA-I_MT
Source:
Medicago truncatula
Organism:
Medicago truncatula
Taxonomy:
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; core eudicots; rosids; eurosids I; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
[1] Authors:
Gentles,A. and Jurka,J.
Title:
Copia-like retrotransposon COPIA_MT
Journal:
Repbase Reports 4:(11) p.287 (2004)
Abstract:
COPIA_MT is a copia-like retrotransposon with ~1240 bp LTRs, and a 5 bp target-site duplication. Average similarity to consensus is 94%. It is most similar to copia-like retrotransposons TORT1 (Lycopersicon esculentum) and PREM2_ZM (Zea mays). Genscan_predicted_2378aa: MSGDEESVTTKYTSVKHDYDTADKKTDSGKAPKFNGDPEEFSWWKTNMYSFIMGLDEELWDILE DGVDDLDLDEEGAAIDRRIHTPAQKKLYKKHHKIRGIIVASIPRTEYMKMSDKSTAKAMFASLC ANFEGSKKVKEAKALMLVHQYELFRMKDDESIEEMYSRFQTLVSGLQILKKSYVASDHVSKILR SLPSRWRPKVTAIEEAKDLNTLSVEDLVSSLKVHEMSLNEHETSKKSKSIALPSKGKTSKSSKA YKASESEEESPDGDSDEDQSVKMAMLSNKLEYLARKQKKFLSKRGSYKNSKKEDQKGCFNCKKP GHFIADCPDLQKEKFKGKSKKSSFNSSKFRKQIKKSLMATWEDLDSESGSDKEEADDDAKAAVG LVATVSSEAVSEAESDSEDENEVYSKIPRQELVDSLKELLSLFEHRTNELTDLKEKYVDLMKQQ KSTLLELKASEEELKGFNLISTTYEDRLKSLCQKLQEKCDKGSGNKHEIALDDFIMAGIDRSKV ASMIYSTYKNKGKGIGYSEEKSKEYSLKSYCDCIKDGLKSTFVPEGTNAVTAVQSKPEASGSQA KITSKPENLKIKVMTKSDPKSQKIKILKRSEPVHQNLIKPESKIPKQKDQKNKAATASEKTIPK GVKPKVLNDQKPLSIHPKVCLRAREKQRSWYLDSGCSRHMTGEKALFLTLTMKDGGEVKFGGNQ TGKIIGTGTIGNSSISINNVWLVDGLKHNLLSISQFCDNGYDVTFSKTNCTLVNKDDKSITFKG KRVENVYKINFSDLADQKVVCLLSMNDKKWVWHKRLGHANWRLISKISKLQLVKGLPNIDYHSD ALCGACQKGKIVKSSFKSKDIVSTSRPLELLHIDLFGPVNTASLYGSKYGLVIVDDYSRWTWVK FIKSKDYACEVFSSFCTQIQSEKELKILKVRSDHGGEFENEPFELFCEKHGILHEFSSPRTPQQ NGVVERKNRTLQEMARTMIHENNLAKHFWAEAVNTSCYIQNRIYIRPMLEKTAYELFKGRRPNI SYFHQFGCTCYILNTKDYLKKFDAKAQRGIFLGYSERSKAYRVYNSETQCVEESMHVKFDDREP GSKTSEQSESNAGTTDSEDASESDQPSDSEKYTEVESSPEAEITPEAESNSEAEPSPKVQNESA SEDFQDNTQQVIQPKFKHKSSHPEELIIGSKDSPRRTRSHFRQEESLIGLLSIIEPKTVEEALS DDGWILAMQEELNQFQRNDVWDLVPKPFQKNIIGTKWVFRNKLNEQGEVTRNKARLVAQGYSQQ EGIDYTETFAPVARLEAIRLLLSYAINHGIILYQMDVKSAFLNGVIEEEVYVKQPPGFEDLKHP DHVYKLKKSLYGLKQAPRAWYDRLSNFLIKNDFERGQVDTTLFRRTLKKDILIVQIYVDDIIFG STNASLCKEFSKLMQDEFEMSMMGELKFFLGIQINQSKEGVYVHQTKYTKELLKKFKLEDCKVM NTPMHPTCTLSKEDTGTVVDQKLYRGRTMSIEEWELIIQAENPVDFASLTHHGCDLVRFYKKQK LMSYFSLLNGPTYEVLVRQFWVRASVFDIEAAKQEEAQLILVDPTLKGKTREEMGLLSFTGTEI RSNVMGIPVTXNEQVIAQAMRRDASGKYFGEEIPNPRTSXWKEIVNETIYGSKDAKPYSTLSME KKMLLKIQNENIFPKGGGSDQPSLGHKVFLHHTITQETTMNVPKYMFKYMIKELKKSQMENRKF VPYGRLLSVIFQEGGLLSALKDVGIYDNQKLGAVTGKIINAATLVKMKLIPANARKKLDTDMHE SDAISDLVTHHIPICKKDPLDVQRAYILDFYKTYNKKISLKDVPEEMYGGDLPVAKGRKSKKKQ ITKEEYLAEDATEEGAQKHKKAKKEKSAMSTILEEVEDLDDVPLIRKRTRSAQETAEQPASEQT GSEQAASEKPPSPKKKREAALQTIKRKRSXRNLKTAEGRRAEMLEELEENWDEDSSPKKAKRTI TSEPIVMPSFEMTEELKQYAREYSASKIAEKKRMKELYEKERDERLKAAGYVPTPDIAALASEL EQETVQYGATLLSQALKNKQASGATSSEPASKAPEAVHPEAXSSGNPSKAPTNTQIPSLPSSPS SSSTESDDQPLSQHIDKLLKTKPTKLTEFGTLDYERTQIEFSKNRIKLCEKFNLPTTHPLYPDI PEPVSVQQPEPNQTNPPNNQTPQKASEVVSEATTSETPQQQESSTLHXLEKHLGGEMQPTPTKA SKTVPGKTVLENQQTQTIPEQTVPEQTASEQVAPDQTTSEQIASDQTTEPEQQPEPPIIDLTSD QPSTSNTTQTEPSPIPDHILESEYIEEQLIRLSDEIQALILRRTVPVPPIHYYDQWMDLKKSFD ELLDQLRTKX
Derived:
[1] (consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute