Repbase Reports

2004, Volume 4, Issue 11
November 30, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 285

ATLANTYS-I_OS

Internal domain of rice ATLANTYS_OS gypsy-like endogenous retrovirus - a consensus.

Submitted:
00-Oct-2004
Accepted:
30-Nov-2004
Key Words:
gag; pol; ATLANTYS superfamily; Gypsy-like endogenous retrovirus; SZ-19LTR; ATLANTYS-LTR_OS; ATLANTYS-I_OS
Source:
Oryza sativa
Organism:
Oryza sativa
Taxonomy:
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; Ehrhartoideae; Oryzeae; Oryza
[1] Authors:
Gentles,A. and Jurka,J.
Title:
ATLANTYS_OS, a rice Gypsy-like LTR retrotransposon
Journal:
Repbase Reports 4:(11) p.285 (2004)
Abstract:
ATLANTYS_OS is a Gypsy-type LTR retrotransposon from Oryza sativa. It has ~1500 bp LTRs, and a 5 bp target site duplication. There are approximately 30 full-length elements in the rice genome, with average similarity to the consensus of 90%; along with numerous fragments. ATLANTYS_OS is related (59% similarity) to the Arabidopsis thaliana elements ATLANTYS1 and ATLANTYS2. ATLANTYS_OS has weak similarity also to RETROSOR1 and RIRE2 from rice. A characteristic feature of these retroelements is that the normal env encoding domain is replaced by an ORF for a protein of unknown function on the opposite strand. The corresponding LTR is ATLANTYS-LTR_OS. gag-pol: MEFKVRVHGVQGDGAQGLQGGNLNQNSDAAQDFFNNFQDRVDYAVHHALINQSGVLVNTLSNMM KSIADGSIAEHQAAGPVYLQGGVFPNYRPLITDVQPSIQAVPPVAPSAQPTAPASTPLPAPSAL APGQLVNPRLLMREQPQHSGQVVNRLTQDQVAAMFLPPQPTVDPIQQQPIQQTPPIQQVVQPIQ QQVVQPVQQTPPRQQPLQPIQQTPLRQQIYGQFEPMQQQSQGAAQQRPWADVIADVMREQFGLK PKETGSLYRQPYPEWFERVPLPNRFKVPDFSKFSGQDAIKQRHDEPVHEYIQRFREMRNKCFSL SLTDAQLADLAFQGMIAPIREKFSSEDFDSLSHLIQKVTLHEHRSAEARKXSKKVNHVCPYMYG SDDDEDDSEIAAAEWVRSKKVIPCQWVKSSGKEEKYDFDITKADKIFDLLLREKQIQLPAGHTI PSAEELGKKRYCKWHNSGSHSTNDCKVFRQQIQVAIEGGKIKFDDSKKPMKVDGNPFPVNMVHT AGQTADRGRARGFQVNSAKIINKYQRKYDKQQEKHYEEDDDGFDPHWGSEFGIDQADVDEVEEE SAKLVLSPEQAVFEKPEGTENRHLKPLYINGYVNGKPMSKMMVDGGXAVNLMPYATFRKLGRNA EDLIKTNMVLKDFGGNPSETKGVLNVELTVGSKTIPTTFFVIDGKGSYSLLLGRDWIHANCCIP STMHQCLIQWQGDKIEIVPADSQLKMENPSYYFEGVVEGSNVYTKDTVDDLDDKQGQGFMSADD LEEIDIGPGDRPRPTFISKNLSPEFRTKLIELLKEFRDCFAWEYYEMPGLSRSIVEHRLPIKPG VRPHQQPPRRCKADMLEPVXAEIKRLYDAGFIRPCRYAEWVSSIVPVIKKNGKVRVCIDFRDLN KATPKDEYPMPVADQLVDAASGNKILSFMDGNAGYNQIFMAEEDIHKTAFRCPGAIGLFEWVVM TFGLKSAGATYQRAMNYIYHDLIGWLVEVYIDDVVVKSKEIEDHIADLRKVFERTRKYGLKMNP TKCAFGVSAGQFLGFLVHERGIEVTQRSVNAIKKIQPPENKTELQEMIGKINFVRRFISNLSGR GACFEFAYTIKPYATNNQAEYEAVLKGLQLLKEVEADAIEIMGDSLLGIFGRQCWRIVSDIIRG VKIVRSLEQFSERRRRL ATLANTYS-I_OS2p: MKVVNRPSVTEAEFPRLEPIVEDDGEERTHRRCMSYGEYASTPTDAGAKLSAELLKDWFCSFYE GFQKDARVWPHQGTSRCRQEKENQIIGCEYLGSSSKEKDQVKKTKPTDDLPALDPSIEQALDEE EIEDDVDQAAAEPPPPPSPPVQQSSSDQTPSAVGSHHIEEEEQPAAPAIPPHVHKQVYKEELGS IHDKPSDKTTMLRPTEYAIAEDNQKFSA
Derived:
[1] (consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute