Repbase Reports

2004, Volume 4, Issue 10
October 31, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 261

Gypsy6-I_DR

Gypsy6-I_DR is an internal portion of the Gypsy6_DR LTR retrotransposon.

Submitted:
00-Oct-2004
Accepted:
31-Oct-2004
Key Words:
LTR retrotransposon; endogenous retrovirus; gag; pol; Gypsy superfamily; Gypsy6_DR; Gypsy6-LTR_DR; Gypsy6-I_DR
Source:
Danio rerio
Organism:
Danio rerio
Taxonomy:
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Cyprinidae; Danio
[1] Authors:
Kapitonov,V.V.
Title:
Gypsy6_DR LTR retrotransposons from zebrafish
Journal:
Repbase Reports 4:(10) p.261 (2004)
Abstract:
Gypsy6-I_DR is an internal portion of the Gypsy6_DR LTR retrotransposon, whose LTR is deposited in Repbase as Gypsy6-LTR_DR. This retrotransposon belongs to the Gypsy superfamily. Some copies of Gypsy6_DR are flanked by identical LTRs. The internal portion encodes the 354-aa Gypsy6_DR1p gag (pos. 160-1221) and the Gypsy6_DR2p 1418-aa pol (pos. 1092-5345) polyproteins. The polyprotein is composed of the protease, reverse transcriptase and integrase domains. Gypsy6_DR1p: MEDELRELRELVTQLKADNERLRQEQVPAALPGPSNISIPVVSDPPLIDAGPSSTDRFVFVPRD RKCPKFSGRSGIDINEWVEEAEACMRLRHLSSADRAFFLFDHLEGEAREEIRYRPQSEREDPKR VIQVLRDLYGCTKSYVALQESFFSRRQQEGETLEFSLALMSLLEMVKGQSPHGMPNAEILLRDQ FVENVNDCTLRRELKQFVRRQPTATLVDVRGEALRWEREGMPGGARGRSQSVPSVYGIQYGVQG NRSVSSGAKSEMTELRDMLLKQQQQLNQLVQSMSLLQSCSPSLPPPKVNPVICRRCRQPGHFAR NCDGGRMSVRAPSAQITSALTRREQSSSSQPSEN Gypsy6_DR2p: MSSARPFCEKLRWWADVGPCTISPNNFCFNKTRTVILQPAVGKLVPTKLQGHNLVGKRVGSNDH MPCLMSTCPKLVVTIGGVQVPCLVDTGSMVSTITESCFMTNFGLWGQEQLRSCHWLQLRAANGL SIPYIGYLELDIELCGRVVSGCGVLVVKDPPGGMCAQTPGVLGMNVLSRCYQELFGQHGTGLFD LPAVSQAPSFIFQALQNCHQAGVQPVKDAEGQVRVRGRRACRIPGGTVKFVATTCSVQYSGNAV LFEPPISGLPAGLLASPALLKVDGGTVYVPIVNVGTMDVVLYARTIVGVVSKVDVVALPPEVAE VNMVAARVSAQSSPSVQEQIATLDLSKLPEVEQGKVRALLLKYLPVFSSYDGDLGCTNLISHDI PLLDEIPVRQRFRRIPPSEYEVVKAHINQLLETQVIRESSSPYASPIVLVKKKDGGLRMCVDYR RLNAKTRKDAFPLPRIEETLDSLAGACWFSTMDLASGYNQVPVTEKDKPKTAFCTPFGLFEWNR MAFGLCNAPSTFQRLMERLFGDQQCQSLLLYLDDIIVFSSSIDEHLARMEVVLSRLQREGLKAK LSKCAFFQREVRYLGHVISSEGVSTDPGKVEAVANWPCPTSVTELRSFLGFASYYRRFVEGFSK LAAPLHRLVAQLANPKQRKGNAHDFAASWSTECQSSFEGLKIKLTSAPVLAYADFSLPFILEID ASQGGLGAVLSQEQQGKVRPIAYGSRSLRPTERNPSNYSSMKLEFLALKWSMTEKFREYLLGQK CIVFTDNNPLSYLNSAKLGVMEHRWAAHLSAFDFEIKYRSGRSNRNADTLSRQNFSSTGEVQGL CPGVAVPAVLQQVAPDGLVTQVNQVTAFPCPSGSDMGALQEADTVIGEVLVFWRRKLLPTSEER KQLSRLAVILLRQWGRLVEIEGVLYRRVSRPDGGEEVLQVLLLAVMKTEVLTQLHQQHGHQGVE RTSQLVRQRCYWPGMFADIARWCQECERCQCAKGTPSAPSSFMGHLLASRPNEILALDFTLMEP SRSGLENVLVMTDIFTKYTLAIPTRDQRAETVAQVLVAEWFCKFGVPGRIHSDQGRNFESTLIQ QLCGLYGVVKSRTTPYHPAGNGQCERFNRTLHDLLRSLPPSKKSDWPLCLPQVLFAYNTTPHQS TGESPYYLMFGQEPKLPIDFLLGRVKEPSAGSVHGWIVEQQDRLQVAFEGARERLGAAADRRKA RHDLQVREAPLKEGQLVYLRDHSVRGRCKIQDLWSSVVYQVLKAPTESGVVYTIAPVADLSKTK HVHRSLLKAQLGPNLLPSPPEPAMGDGMQPSDEECDGDLLVLVPETPELRGRSRSQGSVPPVPR VVDEELEGRATGETVQPEVVPSNPVRAAEVVVRRTVRSTAGQHSNLHHLPRAVGTGTVSSIATN PFGTFFRPWD
Derived:
[1] (consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute