Repbase Reports

2004, Volume 4, Issue 1
January 31, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 24

Gypsy1-I_ST

Internal portion of Gypsy1_ST retrotransposon.

Submitted:
31-Jan-2004
Accepted:
31-Jan-2004
Key Words:
LTR; Gypsy retrotransposon; Tf1 group; gag; protease; reverse transcripatase; RNase H; chromodomain; Gypsy1-LTR_ST; Gypsy1-I_ST
Source:
Silurana tropicalis (Xenopus tropicalis)
Organism:
Silurana tropicalis
Taxonomy:
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae; Xenopodinae; Silurana
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Gypsy1_ST, a self-primed Gypsy LTR retrotransposon from the frog Silurana tropicalis.
Journal:
Repbase Reports 4:(1) p. 24 (2004)
Abstract:
Gypsy1-I_ST is an internal portion of a young Gypsy1-I_ST LTR retrotransposon. The internal sequence is flanked by identical Gypsy1-LTR_SR long terminal repeats. Gypsy1_ST belongs to the Tf1 group of self-primed Gypsy LTR retrotransposons. Its reverse transcription is primed by a heteroduplex formed between a 11-bp portion of PBS (Gypsy1-I_ST, pos. 2-12) and the 11-bp 5' end of the Gypsy1_ST mRNA (Gypsy1-LTR_ST, pos. 182-192). Gypsy1_ST encodes a 1493-aa Gypsy1_STp polyprotein (Gypsy1-I_ST, pos. 14-4302, and Gypsy1-LTR_ST, pos. 1-190) composed of gag (pos. 100-200), protease (pos. 340-450), reverse transcriptase (pos. 560-730), RNase H (pos. 820-950), integrase (pos. 1062-1220) and chromodomain (pos. 1361-1413). Gypsy1_STp: MDPEEAVPDVGRALRGLASRMEAYESQQVRIGQVLDSILSRLPATPAVAEIPPAVVVPLPAMSSAREPRI PPPPRYSGNPQACRGFVTQCQIQFEFQPSQFSCERAKVGYVMSRLEGKPLEWATSLWESQSPLTFDVKEF LQMFRTIFDAPGRVATASSRLLQIRQGSLGASEYAIDFRTLMAETSWNEEAYKAVFYQGLSSRLKDDLVS RDLPDSLEDLIALAIKVDTRLKEHQADKERSKKSHPVLAPRFQNPMIPPPSPQFTTSSSEEPMQLGKARL SAQEKLRRRLSGLCLYCGGQSHLAVSCPVKLGNTPASSKTVVSFAGSIVPKSVEQSHQFHVPVQIRLSSQ AIPVSAFLDSGAAGNFMDLAFAKKVGISLFPVTPSIRVFAIDDRPLSTDTITLTTGELSVQIGALHLEKM SFLIIPCPSSPVVLGLPWLRLHNPSIDWSSGQISRWSQYCQRHCLIPQPLQRVTVSSTSFSALPSVYRDF SDVFCKKSAEFLPPHRRYDCPIDLLPGTMPPRGRTYPLSPAETAAMKEYISENLQRGFIRPSTSPAGAGF FFVEKKDGGLRPCIDYRGLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAF NTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQVKEALSRLREN FLFAKLEKCTFEVPKISFLGYIISSRGFEMDPAKVSAIQKWPLPQSTKAIQRFIGFANYYRQFIKDFSSR IAPILSLIRKGGRPNCWPPVALEAFQSLKDAFISASVLRHPEPHLPFFIEVDASDVGAGAILSQRHSADG KLHPCAYFSKKFSSAEQNYDIGNRELLAVKLALEEWRHLLEGASHPVTIYTDHKNLEFLQSLKRQNPRQA RWSLFFSRFNFVLTYRPGTKNRKADALSRSFSPEDRLPIEQEPIIPPFRIIASVLPQFAEQILLSQSAAP SDTPIGMAFVPPELRLPILQQTHSSKQAGHPGSEKTLELLRRLVWWPTIRKDVRDFVAACTVCATTKASH SRPCGLLHPLPIPSRPWTHLGMDFIVELPPSCGNTVIWVVIDRFSKMAHFIPLRKLPSAVELAHLFIQHI FRLHGFPVEIVSDRGSQFVSRFWRSLCKSLGVSLQFSSAYHPQTNGAAERVNQALEQFLRNHVSLCQDDW SDLLPWAEFAHNNASHSSTGRSPFLSVYGQHPLAFPQDLLLSEVPAADDLAAHMSVIWAATKSNLEKSSL VHKTFADRRRKPSPPYKVGEKVWLSSRNIRLKVPSPKLGPKFLGPFSISEVINPVAVRLQLPPEMRIPNV FHVSLLKPVVLNHFSSAQSPPSAVLVDGQQEYEVEKILDSRLSRGSLQYLVQWKGFGPEECSWEKDSDVH APRLVKAFHDQFPQKPRPSGPVAPRGGGGTVMNRRRSLPAPVRRRPSSRRGESKMAAPRAPRGRRDAGAM TSRAMAPNSNLKGRQRPRFNARV
Derived:
Positions 67702 63401 Accession No AC146867 GenBank
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute