Repbase Reports

2004, Volume 4, Issue 1
January 31, 2004
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 15

GYPSY25-I_AG

GYPSY25-I_AG is an internal portion of retrotransposon GYPSY25_AG - a consensus sequence.

Submitted:
31-Jan-2004
Accepted:
31-Jan-2004
Key Words:
LTR retrotransposon; Gypsy clade; mag lineage; 5-bp TSD; gag; AP protease; reverse transcriptase; RNase-H; integrase; GYPSY25_AG; GYPSY25-LTR_AG; GYPSY25-I_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Tubio,J.M.C., Costas,J.C. and Naveira,H.F.
Title:
GYPSY25_AG, a member of the mag lineage of the Ty3/gypsy group of LTR retrotransposons in Anopheles gambiae.
Journal:
Repbase Reports 4:(1) p. 15 (2004)
Abstract:
GYPSY25_AG is a family of gypsy-like LTR retrotransposons that, according to the aminoacid sequence of its reverse transcriptase, is phylogenetically grouped with representatives of the mag lineage of other organisms. GYPSY18_AG, GYPSY19_AG, GYPSY20_AG, GYPSY21_AG, GYPSY22_AG, GYPSY23_AG, GYPSY24_AG, GYPSY26_AG, GYPSY27_AG and GYPSY28_AG are other members of this same lineage in Anopheles gambiae. The GYPSY25-I_AG consensus was reconstructed after multiple alignment of 8 copies. The consensus encodes the 1470-aa GYPSY25_AGp gag-pol like protein (pos. 210-4619). The sequence of the LTRs flanking GYPSY25-I is deposited as GYPSY25-LTR_AG. GYPSY25_AGp: MLNPDEMMEEEEHRRLSQNWGGNAVFGNGQQQPSQSNVALPAQPPLQNVVGAPSQQGASTSGQDAGMLSQMLQLLQQQMN QQQQLMAQMLKYQQQSVPQPSQPSLIPTNPELIIDALASNISEFRYEAESGATFKAWYERYEDLFLRDASRLDDGAKVRL LGRKLGTAEHARFTSFILPRAPRELTFDETVAKLTALFGRTESLLSKRYKCMQITKAPREDLLTFSCRVNRACVDFEFAG MNEEQFKCLILVCGLKEEVDSDMRNRLLARIEEKHDVTLEQLSAECQRITNIKVDSALIANESGERVLAVNSGGYRQKQF QFNRQQYQSYGQPTQAHARANDNTMSVQKPLNACWLCSGPHWKRECPYRSHECADCGRLGHREGHCEVVNRFQRRGYNKK GTNVATRVVNINVCNVEARRKYVHILINGRPTKLQLDTASDITVISEGLWKDIGQPSLIRATVKAKAASQEYLELMGEFE ALLTIASRTQKAVVRVAYANLLLLGADVVESFSLGSIPMDHYCSSIDAESATQMTWEERFPTVFRGMGLCTKSSIKLKVK EGSRPIFRPKRPVAYAMLKTVDEELDRLETLNVITPVDYSEWAAPIVVVRKANGKIRICGDYSTGLNDLLQSHEYPLPLP EDIFAKLSKCRIFSKIDLSDAFLQVQIDKEYRPLLTINTHRGLYHYNRLSPGIKIAPAAFQQLIDTMLAGLSGVCGYMDD LIIGGLTDEDHDKTLGQVLKRIEEFGFTLRADKCVFRMCQIKYLGHVIDGRGIRPDPEKISAIQNLPPPTDIAGVRSFLG AINYYGKFIPMMRDLRFPLDSLLKDEKQFKWTKECEAAFMKFKEVLSSELLLTHYDPSAEIIVAADASSVGIGATLSHKF SDGSIKVVQHASRALTKAESNYSQIDREGLALVYAVTKFHKMLYGRHFRLQTDHRPLLRIFGSKKGIPIYTASRLQRFAL TMQLYDFTIEYIQSGMFGNADILSRLIRNHAKPEAEYVIASLNLEEDLRSVAINAISNSSPLCFRDVEKSTQADPLLRKV YLYIQEGWPRDATFGSELARFHVRREALSTVEGCILFGERLVIPEDLRAHCLEQLHRGHPGVERMKSLARSYVYWPRLDD EIVQYVAACEACAAAAKTPPQAKPTPWPKPSGPWQRLHVDYAGPILGDYFLVVVDAFSKWPEIVKTSTTTSRATVAILRG LFARFGMPLSIVSDNGPQFTSQEFKNFCECHGIRQVTTAPFHPQSNGQAERFVDTLKRALKKIQTGGTSMDEALDTFLQA YRTTPNPALEWNTTPAEIIIKYPVRTHLELLRRPPVVEEETEITAAGLQPGDVVATKKYYQNTWKWISAEVLRRLGTVMY ELTSRNGRMMRRHIDQIRKRSVKEPHQLVQDSETPTQLPIDILLGEWSLTVPNEPLPLSSTTEELRTVPSPQPFSPAQVA PSESNHRKIRSPRRSSRNRKLPRRFDAFIL
Derived:
[1] (consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute