Repbase Reports

2003, Volume 3, Issue 7
July 31, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 135

Harbinger2_TP

Harbinger2_TP is an autonomous DNA transposon - a consensus sequence.

Submitted:
31-Jul-2003
Accepted:
31-Jul-2003
Key Words:
DNA transposon; Harbinger superfamily; transposase; DNA-binding protein; Harbinger2_TP
Source:
consensus
Organism:
Thalassiosira pseudonana
Taxonomy:
Eukaryota; stramenopiles; Bacillariophyta; Coscinodiscophyceae; Thalassiosirophycidae; Thalassiosirales; Thalassiosiraceae; Thalassiosira
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Harbinger2_TP, a family of autonomous Harbinger-like DNA transposons from diatom Thalassiosira pseudonana.
Journal:
Repbase Reports 3:(7) p. 135 (2003)
Abstract:
Harbinger2_TP copies are ~95% identical to the consensus sequence, they are flanked by the TTA 3-bp target site duplications. This transposon has 43-bp terminal inverted repeats (1 mismatch). Harbinger2_TP encodes the 470-aa Harbinger2_TP1p transposase (pos. 298-1707) and the 486-aa Harbinger2_TP2p DNA binding protein (pos. 3224-1767). Harbinger2_TP1p: MSRSGSDPFNYQEYLDDEEELDALHQAKRRKEAIIYASAIATVAAASIPFGVLASAHQGRVPGAVTVKRQ RLAVEDYCQTLSDKHFRRRYRMGKESFWNLLHIVGDHLPSTGENRKNGCVPNGPISHAAHLSMALRIAAG ADPLDVATNHGVNDNQPMVSFWLVIDAIHKSPQLDIQFPTSHEEQEKVAKEFQSKSSIGISCCVGAIDGI LIWIHKPSDSDCDMLGFGQTKFFCGRKKKFGLNMQAVCDAQRRFLWVDIRYPGTTSDFFAFDQSSLKDKL EQPGFLHSGLCLFGDAAYANSPYMCSPFRSATGTQDDFNFFQSQLRITIECAFGMLVHRFGILRKAFPVN VTVSKTNTAVLGLCKLHNFCIQSSNCGDDIVASDFRDASNIIMEGGLVLPRIDRDDGSGNRWRYEEEDRL DNLLDGGQHMDDHSDVDRRRYRYRNELPRQSIHDYIVLNEFRRPDRRATR Harbinger2_TP2p: WPPIADDAPPIAADAPPIAADAPPITAGAADDAASDEDSLSSEVSRHDTEGALTSEALRRAVDGAVDVDE GADDVNAPGEVEKMLTDDNETPPKERTKRTLFLAKTIGIDVDNDLAPFLEKNGKKSITITKKMILQEIKR RDPRIKIKNTKNTTNESLMAVLPDLTDARDVAYIRTQYAMIRDHLLNGVSACTPTAQRKGTDIMRVFLLI NMLPDLRRAYSLSQTGSNREMLDAGKTHMSKFLQLLVRYFNDPSLEVSTPCQPSLHYSFAEPIACNKGEF ELTESKAKKLISDSRRYLTTMINDWEKSGNGSNQRLDDSDDDHDFVFDLWGRFDPETCDGDDRANFLRHL PHYWLMVWHLCDEGDLLRFTCAQLRDDHTASSLSAPPSVSRGSGSARKLAQQTLELHKEIAESVKNIGRA VARCSDDTSYERASKIRRLDKLRADRYLVFRDSKCQASSQEERDAAADYVKDLDEMIDSLKAELMG
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute