Repbase Reports

2003, Volume 3, Issue 6
June 30, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 119

piggyBac1_CI

Autonomous DNA transposon piggyBac1_CI - a consensus.

Submitted:
30-Jun-2003
Accepted:
30-Jun-2003
Key Words:
Nonautonomous DNA transposon, piggyBac superfamily; TTAA target site duplication; transposase; piggyBac1N_CI; piggyBac1_CI
Source:
consensus
Organism:
Ciona intestinalis
Taxonomy:
Eukaryota; Metazoa; Chordata; Urochordata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
piggyBac1_CI, a family of autonomous piggyBac DNA transposons from the sea squirt Ciona intestinalis
Journal:
Repbase Reports 3:(6) p. 119 (2003)
Abstract:
piggyBac1_CI is a family of autonomous elements related to the hAT superfamily. The consensus was reconstructed from 5 copies. It encodes a 773-aa piggyBac1_CIp transposase (positions 263-1981). A zinc finger is present at the C-terminus of piggyBac1_CIp. piggyBac1_CI has 13-bp terminal inverted repeats and is flanked by the TTAA target site duplications. A piggyBac1_CIp-like transposase was also involved in propagation of the piggyBac1N1_CI nonautonomous element. piggyBac1_CIp: MFSATAAAEILMDAGSDLSDLESDHDEDDNVGSFIVPNVADISDSDSESSDDSLPPPPPPANVWKSSITQ QSLNSFLGEHGPSSHACVSNDDSPLEYFRLIFTDELLTLVVEETNRYAAQYLQKTPLSSKSRAHNWKPVD AEELSLFLGLTLLTGIVHKRGKLESYWSKNSMIETPFFGKCMSRNRYQAITGFLHFNDNEKLAENNDNDK LYKVRPVYDLIVARWKALYNLGEHISIDEGMMKWRGRLGFRVYNKDKPIKYGIKSYILADSHSHYCWNLD MYHRVQKTLKETVSQILTSKCHFLWHSLYMDNFYNSVSMSQMLLAFQIHSVGTLRSNRGEPREIRTPPNQ MKKGDIIARQNQSVTVLAWKDKRVVKAISTKHDASVTTITRRQRRGGEKESVEKPVCIADYNLHMSGVDQ VDQMISYYPCHRKSLKWTKKVFFYFMTISVHNAYILYKSKSSAKSCKTLYSFILTLVSQLCQQDRLQPQI DDENLAGPPPKSPRIDSTKRLKGGFKKHVIALYLQLKKRQQRKDHVVRAWKTVAERTRYYCAYCNVPLCV IPCFTKYHACAEF
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute