Repbase Reports

2003, Volume 3, Issue 6
June 30, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 107

HAT5_CI

Autonomous hAT-like DNA transposon HAT5_CI - a fossilized copy.

Submitted:
30-Jun-2003
Accepted:
30-Jun-2003
Key Words:
Nonautonomous DNA transposon, hAT superfamily; 8-bp TSD; transposase; BED zinc finger; HAT5N_CI; HAT5_CI
Source:
sea squirt
Organism:
Ciona intestinalis
Taxonomy:
Eukaryota; Metazoa; Chordata; Urochordata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
HAT5_CI, a family of autonomous hAT DNA transposons from the sea squirt Ciona intestinalis
Journal:
Repbase Reports 3:(6) p. 107 (2003)
Abstract:
HAT5_CI is a family of autonomous elements related to the hAT superfamily. It encodes a 608-aa hAT transposase, HAT5_CIp (pos. 256-2079). The N-terminal portion of HAT5_CIp (pos. 10-55) is the BED zinc finger. HAT5_CIp: MSAIAKVSSSKVWDYFNVSEGSVKCQLCKNLVSQGSTSSAQKNTSNLWSHLRSKHREVEVYEQAHCHKIG KSSKVVQPTLFQSFDNSRKWSNTDGRSRNLDKLIIEMIATDIQPFSVTNDIGFKRLLATAEPRYNLKDEK YYRTEMLPKVHLKVVDKIKNMLKEENAGESLSFTTDCWSGSTESLMSLTAHFIDNQWKRKQLVLSVKSMS ESHTGDYIGKVFLDILSQWEIDRSRVLLVLRDSGANVVKGMRVADVSDFSCCAHTMQLIIKEGIESQRVV IDIVAKLKRCATHFNHSTLAKKRLHAIQNQVGLPVHSIIQAIPTRWNSTLHMLRRMLEQKHALSIYASEY GHFSLPNTYEWELVAKLVALLIPFETITLEISHSEASASCILPSIAVLKALLQSDNEATFGIGTIKGTMC ESLLRRYCNVENVKPVVIACLLDPRFKDKPFSSEIVLGRAKDWLINEVKEQDQGEEPVAAKKQKQSSDSE NDLLSNLYKNVLGQGSTDNNECESTDVQTEINKYLSEPLIDRSTGHPLDWWKNNETRFVILAKLARKYLN PPPSSVPSERDFSTIGNIYEDKRSRLTGEHAEQLCFLYYNLHLLEYNY The nonautonomous HAT5N_CI is a derivate of the HAT5_CI transposon. They share common ~100-bp 5' and ~140-bp 3' termini, respectively.
Derived:
Positions 115974 113764 Accession No AABS01000231.1 GenBank
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute