Repbase Reports

2003, Volume 3, Issue 6
June 30, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 105

HAT4_CI

Autonomous hAT-like DNA transposon HAT4_CI - a fossilized copy.

Submitted:
30-Jun-2003
Accepted:
30-Jun-2003
Key Words:
Nonautonomous DNA transposon, hAT superfamily; transposase; BED zinc finger; HAT4N_CI; HAT4_CI
Source:
sea squirt
Organism:
Ciona intestinalis
Taxonomy:
Eukaryota; Metazoa; Chordata; Urochordata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
HAT4_CI, a family of autonomous hAT DNA transposons from the sea squirt Ciona intestinalis
Journal:
Repbase Reports 3:(6) p. 105 (2003)
Abstract:
HAT4_CI is a family of autonomous elements related to the hAT superfamily. It encodes a 607-aa hAT transposase, HAT4_CIp (5 exons, 695-918, 1077-1099, 1214-1626, 1685-2399,2454-2902). The N terminal portion of HAT4_CIp is the BED zinc finger. HAT4_CIp: MKDSIMKRGRKLSSDVWEHFSPPNVENKVKCNYCHATLSYCQSTGSLMKHLKQKHPFTSL TRSEEGDSPSPSTSQLSVGETSIGDLRPINLVEGENFQALIKHLAPGYNIPSRMTFMRKL KQSLEICKAKIRDELSNANSIALTTDLWSSIRMQSFIGVTAHVISKDSAELRNFVLATKE VLEESHTGENIVEWIESILVDYHVSPAKIVGIVTDNGSNMRCVKEAVAIGPIKSAIGAAR HLVVYFCQSAKASAALRSQQTRSGDNCDLILDVPTRWNSTYAMVKRLCRLQWMVRQVLCD TSITPRTKAMHLELKDANWVILQQLIDVLAPIKTASDYIEGDQYVTLGSARTKAMHLELK DANWVILQQLIDVLAPIKTASDYIEGDQYVTLGSALPLIKSLAEKYNSNQGLETLQTPSH TSIMQAKSTMELSIKRRFPLFFANTGSMAPHPFFTKQHVRDELETEITTEGLDANETTQL RNTAKTRSQTSNDNPELCLQSILQCGVENAASSDDSIEEDCVAAEVSKYLKDKTACTDPL VWWKNKKSEYPQLYLLILKYLCIPATSASSERCFSSAGLTATALWSRLTGEHLEALNILH CNRTLLH The nonautonomous HAT4N_CI is a deletion derivate of HAT4_CI.
Derived:
Positions 928 4496 Accession No AABS01001724.1 GenBank
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute