Repbase Reports

2003, Volume 3, Issue 6
June 30, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 103

HAT3_CI

Autonomous hAT-like DNA transposon HAT3_CI - a fossilized copy.

Submitted:
30-Jun-2003
Accepted:
30-Jun-2003
Key Words:
Nonautonomous DNA transposon, hAT superfamily; 8-bp TSD; transposase; HATN5_CI; HAT3_CI
Source:
sea squirt
Organism:
Ciona intestinalis
Taxonomy:
Eukaryota; Metazoa; Chordata; Urochordata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
HAT3_CI, a family of autonomous hAT DNA transposons from the sea squirt Ciona intestinalis
Journal:
Repbase Reports 3:(6) p. 103 (2003)
Abstract:
HAT3_CI is a family of autonomous elements related to the hAT superfamily. HAT3_CI encodes a 428-aa remnant of the HAT3_CIp transposase (positions 661-1944). HAT3_CIp: PEDSGQGRNCCVLSHQSRPCRAQERWQKVVKEAFLEAADSLFNNFNNKTKIVKSIEEVQLSRSTITRRCE VMAVDVEEQLGKDVDLCQFFFLQFDESTDMVDVAELRVFLRMVFEDMSAKEELLTILPLKRHTRGEDIFN TFKEFVNEKKLPLCKLISITTDGAPAVIGRTNGFIALCKQSESFPDFLNYHCLIHQQALCCNILNMKEVM DVAVKIVCSIRARSLQRRLFRAHLEENDFQHTDLLLQTNVRWLSRAKYLARFIELLLEIKTFLRLSNRVE YHTKLDDHQWLLDLSFLTDLTGELNVLNIELQGKDKDVANMMSSVNTFKSKLQLISSRLQRDDLRNFPYM QAELLRQGKRVTQLKTACYKEQVQRILLEFERRFADFSSIEPVVLCVTHLLQVLMLVASLPKSNHFLAWK SPLLRKKF HAT3_CI is flanked by 15-bp terminal inverted repeats (4 mismatches) and 8-bp target site duplications. The nonautonomous HATN5_CI is a deletion derivate of an autonomous element 80% identical to HAT3_CI.
Derived:
Positions 10081 7580 Accession No AABS01000855.1 GenBank
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute