Repbase Reports

2003, Volume 3, Issue 6
June 30, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 102

HAT2_CI

Autonomous hAT-like DNA transposon HAT2_CI - a fossilized copy.

Submitted:
30-Jun-2003
Accepted:
30-Jun-2003
Key Words:
Nonautonomous DNA transposon, hAT superfamily; transposase; BED zinc finger; HATN4_CI; HAT2_CI
Source:
sea squirt
Organism:
Ciona intestinalis
Taxonomy:
Eukaryota; Metazoa; Chordata; Urochordata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
HAT2_CI, a family of autonomous hAT DNA transposons from the sea squirt Ciona intestinalis
Journal:
Repbase Reports 3:(6) p. 102 (2003)
Abstract:
HAT2_CI is a family of autonomous elements related to the hAT superfamily. HAT2_CI encodes a 604-aa HAT2_CIp transposase (positions 422-2233). The N-terminal portion of HAT2_CIp (pos. 4-44) includes a BED zinc finger. HAT2_CI is flanked by 12-bp terminal inverted repeats. The HAT2_CIp transposase was also involved in propagation of HATN4_CI nonautonomous elements. HAT2_CI and HATN4_CI share common ~80-bp 5' and ~250-bp 3' termini, respectively. HAT2_CIp: MPVSNVWQWFSKSESDVSCKLCSKGFSLRCSTTTLKYHLQSSHKDKLAGASGPSSSGSSESDVLVQSDIR QYQVRPKLSDDESRRIDVLVSSFMWRDMRPFHIVEGQGFRDLVHGLNHQYKIKHRSTYQAITERTYKSAK SFLLDVLQHANYMGITTDMWTSIRNDSYITVTVHWITDDWKMQHGVLTTECMTEANTAENLSLRLTDVLA EYRITSNKISATVTDNGRNIKKAVDLLDDWTQLSCFAHTLQLCVKAGLDIPAVSRMRAGARRLVNHFKHS SKATAALREKQFSLRPGETVLDLITECPARWNSTFDMFDRLLLLQWCIRAVLTDFKITKPSVASSLQMSS TQWDLCQSLVHVLKPLKIATTMMSASKYPSIPWIYPVLFTLQKKLESCDIDSGATAHCKTAIREQIDKRF FASNWHRNLPVLASVLDPRYKFLKFIDNDATRQEVYDHLKGQITEFAAKYSDFEQHLQSESTNEAHTFDP FEELCGKDTKKQTVVAPEDEIKAYLREPAQPSDSDPLQWWKLNAARLPTMSLMARFYFCIPATSVPSECI PATSVPSESVFSSAGHIVNAKRASLTPANVNMLVFLNKNAHMII
Derived:
Positions 23356 26032 Accession No AABS01000165.1 GenBank
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute