Repbase Reports

2003, Volume 3, Issue 6
June 30, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 101

HAT1_CI

Autonomous DNA transposon HAT1_CI - a consensus.

Submitted:
30-Jun-2003
Accepted:
30-Jun-2003
Key Words:
Nonautonomous DNA transposon, hAT superfamily; 8-bp target site duplication; transposase; BED zinc finger; HATN1_CI; HAT1_CI
Source:
consensus
Organism:
Ciona intestinalis
Taxonomy:
Eukaryota; Metazoa; Chordata; Urochordata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
HAT1_CI, a family of autonomous hAT DNA transposons from the sea squirt Ciona intestinalis
Journal:
Repbase Reports 3:(6) p. 101 (2003)
Abstract:
HAT1_CI is a family of autonomous elements related to the hAT superfamily. There are ~10 HAT1_CI elements in the C. intestinalis genome, they are 97% identical to the consensus. The consensus was reconstructed from 5 copies, therefore a transposase encoded by HAT1_CI is not completely reconstructed. The draft version of the HAT1_CIp transposase is 575-aa long (positions 617-2314). The N-terminal portion of HAT1_CIp (pos. 8-54) includes a BED zinc finger. HAT1_CI is flanked by 15-bp terminal inverted repeats (1 mismatch). The HAT1_CIp transposase was also involved in propagation of the HATN1_CI nonautonomous element. HAT1_CIp: MQSSRHKSKVWEYFSVEKGAVNCLLCKLNLSQGSTDTKKKNTTNLWSHLRVNHQKEYQESQKQILIEHKG QPTLEESFNQVRRWSNIDPRSKELDRIILEMMATDNRPFALVTAPGFQRLMAKAEPRYQLKSEKYYRTDM LDQVYCLVEKKIRELLCVENAGHFLSFTSDCWTGSTESLMSLTVHFIDTEWNRRQAILNAKAMMGSHTGQ YVSEIFKTMLQHWQINENRVFLVLRDSGSNMIKGMKLIDMPSLSCFAHTLQLVIEDGIKTQRTVINILAR LRKIATHFNHSVLAKQKLQDIQEQISVPKHTILQSVATRWNSSLDMLKECWSKEEHXLFMKVIMEQSHVP PVMNGNXLKIXLIHCLEPFKTITLEMSKSNACLSIILPNICALRLLLKNVGPKSRGIQTMRGEMLTSLEK RFLTIEQNKEVVMACMLDPRFKTKVMSPLSSQQGKEWILEEINNQNSSSPQPKKICLQAQSSSAAAHEPQ RSCLDAVFESLLGSSSIESGPTHELAQYLGEPVQKKNTDPHLWWKNNSCRFPSLEATARKYLSAPPTSIP SERLFSEIGNIYDLR
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute