Repbase Reports

2003, Volume 3, Issue 5
May 31, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 97

PegasusA

PegasusA is a hAT-like autonomous DNA transposon - a consensus sequence.

Submitted:
31-May-2003
Accepted:
31-May-2003
Key Words:
Autonomous DNA transposon; hAT superfamily; 8-bp TSD; transposase; MITE; PEGASUS; PegasusA
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[2] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
PegasusA: a family of autonomous hAT-like DNA transposons from African malaria mosquito.
Journal:
Repbase Reports 3:(5) p. 97 (2003)
Abstract:
PegasusA is a family of autonomous DNA transposons that belongs to the hAT superfamily. The PegasusA consensus sequence was built from 4 copies ~3% diverged from it. PegasusA encodes the 499-aa PegasusAp hAT-like transposase (exons 312-600, 1347-2053 and 2317-2820). PegasusAp: MSKTSGEKRKLREIIAEGCVGFENGHFVCTIDEVNGCKYRQKNEKYEPGNFIRHIRSMHP DLAKSRGLLQEDGEVPIKKRKVSKVPVAIDRQKLLEGRPQENCSLPNHYLDLTEAIEKEF YQYITLVRCAVHTMQLSVVDVVKTFDGEIRKCTAVSNNCRKIMYKTVFNNESLPPLYSKT RWGGIFEMLNHFFKQEDFFNELGQQHSELGEIYYINEKVFPYLNISFFSDLTEQWDFIKE YVVAFVPVYISTKAMQAKHTSLNDFYLSWMKTILKVGSIPGNRFVEPLTKALKNRLKNLK ESIVFKAALLLDPRFNYLNSKFFNQEEKEEIRSFIISTSERIHLCKAKVQPSSSSSPSNA PNGTLNSSSDFDLYFTELYGGSLPEQNAEEIQTSANKILRQLISLDAEAHQNSHFDVWNF WLMRKSTHPELYEVATLLLSVPSNQVSVERAFSALGLVLSDKRTRMNDDTLENILLIKLN QPLLEKILPDLYEWNKEDI Nonautonomous derivate of PegasusA was described as PEGASUS [1]. PegasusA is flanked by imperfect 16-bp terminal inverted repeats (4 mismatches).
Derived:
[2] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:
  1. Besansky,N.J., Mukabayire,O., Bedell,J.A. and Lusz,H.
    Pegasus, a small inverted repeat transposable element found in the white gene of Anopheles gambiae
    Genetica 98, 119-129 (1996)

© 2001-2020 - Genetic Information Research Institute