Repbase Reports

2003, Volume 3, Issue 5
May 31, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 95

Merlin1m_CE

Nonautonomous DNA transposon Merlin1m_CE.

Submitted:
31-May-2003
Accepted:
31-May-2003
Key Words:
Nonautonomous DNA transposon, Merlin/IS1016 superfamily; 8-bp TSD; Merlin1m_CE
Source:
Caenorhabditis elegans
Organism:
Caenorhabditis elegans
Taxonomy:
Eukaryotae; mitochondrial eukaryotes; Metazoa/Eumycota group; Metazoa; Eumetazoa; Bilateria; Pseudocoelomata; Nematoda; Secernentea; Rhabditia; Rhabditida; Rhabditina; Rhabditoidea; Rhabditidae; Caenorhabditis
[1] Authors:
Feschotte,C. and Wessler,S.R.
Title:
Merlin1m_CE, a nonautonomous family of Merlin/IS1016-like DNA transposons from the the nematode C. elegans
Journal:
Repbase Reports 3:(5) p. 95 (2003)
Abstract:
Merlin1m_CE contains a short stretch of coding sequences (41 aa, VEIDESLFSKRKNNSGRILPQLWIFGGICRETGEFFLTEVD) with 46% identity (60% similarity) to the Merlin1_CB transposase (from nematode C. briggsae). Merlin1m_CE TIRs are very similar to those of elements from the PAL8C families. Presumably, PAL8C_1-PAL8C_5 belong also to the Merlin group of DNA transposons.
Derived:
Positions 40499 40112 Accession No AF003130 GenBank
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute