Repbase Reports

2003, Volume 3, Issue 4
April 30, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 84

Tc1-1_AG

Tc1-1_AG is an autonomous DNA transposon - a consensus sequence.

Submitted:
30-Apr-2003
Accepted:
30-Apr-2003
Key Words:
autonomous DNA transposon; mariner/Tc1 superfamily; Topi; Tc1-1_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[2] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Tc1-1_AG, a family of autonomous mariner/Tc1-like DNA transposons from African malaria mosquito.
Journal:
Repbase Reports 3:(4) p. 84 (2003)
Abstract:
There are ~50 copies of Tc1-1_AG in the genome. They are ~98% identical to the consensus sequence. This element has 24-bp terminal inverted repeats. This transposon is inserted preferentially into the GTAC target site (the TA target site duplication). Tc1-1_AG encodes the 332-aa Tc1-1_AGp transposase (pos. 272-1267). Tc1-1_AGp: MGRGKHCTPEERKHIQGLYRENVPIKTICKAFGRSRTFVDNAIRSEATGKSTGRPRKTTADVDAQIVEMI RADPFKTCTRIKQELGLQVSAKTVSRRLHAAGFCARRPRKVRKLxPHHVEARIRFAEEHLAASIFWWSKI IFSDESRINLDGSDGIKYVWRFPNQAYHPKNTIKTLSHGGGHVMVWGCFSWHGTGPLFRINGTLNSEGYR KILSRKMLPYARQQFGDEEHYIFQHDNDSKHTSRTVKCYLANQDVQVLPWPALSPDLNPIENLWSTLKRQ LKNQPARSADDLWTRCKVMWERIxRSECRNLIGDMAKRCQEVIANNGHQIDR
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:
  1. Grossman,G.L., Cornel,A.J., Salazar-Rafferty,C., Robertson,H.M. and Collins,F.H.
    Tsessebe, Topi and Tiang: Three distinct subfamilies of Tc1-like transposable elements in the malaria vector, Anopheles gambiae.
    Direct submission to GenBank (January 1999)

© 2001-2019 - Genetic Information Research Institute