Repbase Reports

2003, Volume 3, Issue 4
April 30, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 81

GYPSY6-I_AG

GYPSY6-I_AG is an internal portion of the GYPSY6_AG LTR retrotransposon - a consensus sequence.

Submitted:
30-Apr-2003
Accepted:
30-Apr-2003
Key Words:
LTR retrotransposon; Gyspy clade; 4-bp TSD; gag; reverse transcriptase; integrase; GYPSY6_AG; GYPSY6-LTR_AG; GYPSY6-I_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Pavlicek,A., Kapitonov,V.V. and Jurka,J.
Title:
GYPSY6_AG, a family of LTR retrotransposons from African malaria mosquito.
Journal:
Repbase Reports 3:(4) p. 81 (2003)
Abstract:
GYPSY6_AG is a family of autonomous gypsy-like LTR retrotransposons. GYPSY6-I_AG, an internal portion of GYPSY6_AG, is flanked by GYPSY6-LTR_AG LTRs. The GYPSY6-I_AG consensus sequence was reconstructed based on multiple alignment of 3 copies; they are less than 1% divergent from the consensus sequence. Two elements are nearly 100% identical to the consensus and contain intact ORF, thus the family appear to be active. The consensus sequence encodes the 1511-aa GYPSY6_AGp protein (pos. 28-4560), composed of gag (zinc-finger, 317-353), reverse transcriptase (pos.690-859) and integrase (pos. 1207-1350) domains. GYPSY6_AGp: MSKEDGKVLRELESVSCPNSEPATIGKIRALYNDVLSITNTIESECIDQGDVDPKPTYSVTKEEASSAKP MHLSNHVEDEIAILKQRLEILELRSKIAVLENEKQASKINQPLLPEALKQIIPQFEDGVGVNHWLKVIDH SSEMYGWDDNTTMLYASSRLVGAAKEWYNGCRSEICTLSEFTAGLKRAFPDNRNEAAIHKELMSVAKRRD ETYTAFIYRVNAIGKSGNVSDEAILTYIINGLARDRIYDNLVVRDYKDIYELMAHIQRCETLLKMRDTPS TSSYQRLENTRVNENQREKPNRAAQINRKDALASVRCYNCSSFGHYSGQCLKPRRTIGACFSCGQHDHQK LECANAAGKNNIPVFATNETTSERDSYADIEKIKAYQQVSVSLETLNGVKKFHSYVYSLFDSGSPTSFIS ETFVPDGAAKKASPSGYKGLGNKPLSSLGHIVCNIGFRHKIISHRFIILSKSDMDWPIIIGRDALDKLNV HLYHSFYLYSKEKLLSLNNKTMNYLKPHMMERLISLGVLKNDSDDRLKRKMPLIKAIEENKYNLKEIPFH SLNHAILESSLSNRKKDDNSNQSFISDEFKYGETFAEMCAIDVNLPEHDFNIGSIVGIRERKQISSIIID NYIKRQTGKIYKENHKMTISLTHDTPIFCKPRKLSFAERNHVREIVKDLLQRKIIRQSNSAYASPIVLVK KKNGETRMCIDYRPINKITVRDNYPLPLIDTCIEHLGDKQYFTLLDLKNGFHQIDMAPASIKYTAFVTPD GQYEYVKMPFGLKNAPSEFQRCINSVLREFIDNREIVVYLDDIIIASKDLHNHLRILSAVLQTIRKNGLE LKLEKCMFVHDELDYLGYHASSKGIRPSNYHIKAIENYPQPSNSKEVQRCLGLFSYFRRFVPSFSTIAKP LSSLLKQNAPYNFDGPCISAFNTLKEMLIKAPVLAIYDPQKETELHCDASSVGFGSVLLQKQFDGKFHPI AFFSKTASPAEAKLHSYELETLSVIYALKRFHTYVHGVPIRIVTDCNSLVETLKNKNCSAKIARWSLFLE NYDYTMQYRPGCSMGHVDALSRQQIAVATQDLDIDSQLRIAQSRDQEIERLKSVIERGMVNGYTLHDNLV FRKLENGRLQFRVPRDMINNVIRSTHESIGHLGVDKCCTQISKNYWFPLMKTRVENFIKNCLKCIIYSAP ARKNNRNLHSIPKIPLPFDTIHIDHLGPLPSLQSKKKYILVVIDAFTKFTKLYPTTNTSSREVCNALNQY FSYFSRPRRLISDRASSFTSTEFKQFILKHNITHVLTAVCSPQANGQVERVNRVIVPILSKLSDPIDHAD WSSKLIAAEYALNNTVHSSTRISPSVLLYGIEQKGPNINELTEYLKDNIPTTPRDLESIRVQASENIVNS QFTNETQFMKTHRPAIEFEVGEYVVIRNVDNSVNTNKKLIAKFRGPYVIHKRLPNDRYVVRDIEGFQQTQ IPYDGVLESDKLRRWIASETDLASESLEVSPSDSLAGPDLG
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute