Repbase Reports

2003, Volume 3, Issue 4
April 30, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 79

GYPSY5-I_AG

GYPSY5-I_AG is an internal portion of the GYPSY5_AG LTR retrotransposon - a consensus sequence.

Submitted:
30-Apr-2003
Accepted:
30-Apr-2003
Key Words:
LTR retrotransposon; Gyspy clade; 4-bp TSD; gag; AP protease; reverse transcriptase; integrase; GYPSY5_AG; GYPSY5-LTR_AG; GYPSY5-I_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Pavlicek,A., Kapitonov,V.V. and Jurka,J.
Title:
GYPSY5_AG, a family of LTR retrotransposons from African malaria mosquito.
Journal:
Repbase Reports 3:(4) p. 79 (2003)
Abstract:
GYPSY5_AG is a family of autonomous gypsy-like LTR retrotransposons. GYPSY5-I_AG, an internal portion of GYPSY5_AG, is flanked by GYPSY5-LTR_AG LTRs. The GYPSY5-I_AG consensus sequence was reconstructed based on multiple alignment of 15 copies; they are less than 1% divergent from the consensus sequence. Two elements are 100% identical to the consensus and contain intact ORF, thus the family appear to be still active. The consensus sequence encodes the 1469-aa GYPSY5_AGp protein (pos. 35-4441), composed of gag (zinc-finger, 309-357), protease (403-492), reverse transcriptase (pos. 668-837) and integrase (pos. 1181-1332) domains. GYPSY5_AGp: MLTKEELLCALEVANIEVPPKATLPQLRMLYEQSVPKNKMEEQSTQNFIPQRVCADEDEVTNNGNHVAAA AILMKDKAAPTSSTQGASFDATSHQLELMALRAKIMEMEQRQTFTDGRLVHPEELKHLIPEFSDGLGINK WINTIRYNSELYGWQDRTMLLYAGSRLTGAASEWYNGFRNTLKTFDEFADTIKKAFPDRCNEAVIHSQLA SVYKKISESYTSYVYRVNALGMSGHVSEEAIITYVIRGLSRDPLYDSLVTKDYRDIYDLIDNIKRYESHL LLRKNPERRSPSHINTISPRPIPPRQTTTEPLRCYNCSNHGHHSSQCTQPRRAPGSCFRCGSTSHVIRNC PVPDRRQLTVAAVQGNDNETAHLDSGENGNFVQLEAYQEVSVAFKRNNVWSPGLIITSLFDSGSSKSFIN EAIVPVTKLSAPQPSGFRGIGNVNLQTLGTVQLKLSFRNQTFIHNFYILPKSYMSLSMIVGRDLLSEFNI TLAQFRKHYSKLMLMNLNKDKILNLKKPGFYHKLQTLGLLRSSIQAPLPEVCKDSKLSDPNISSKFISIS DKSEHKQQYDTTFSEMCSINISDEASTINVGEHLSKEQGIALRSIVSNNYINFPDKHIIPSAHKMRISLT HDTPIFTKPRRLSFDERNKVKVIVKDLLEKNIIRPSNSPYASALVLVRKKNGEIRKCVDYRPLNKVTIRD NYPLPLIETCLEHLGNKKFFTLLDLKSGFHQVAMDEDSIKFTAFVTPDGQYEYTRMPFGLKNAPAEFQRF INTILRKFIENEKLVVYIDDILIASQDFKEHLEIVSEVLHTLRNNGLELRLDKCKFAYDELDYLGYKANH SGICPSDNHVKIIKNYPVPQNTKQVQQCLGLFSFFRRFVPHFSSIAKPLTNLLKNNVPFIFDDECKKAFE TLRDKLIVAPVLAIYDPKRETELHCDASSIAFGSVLLQKQDDGRYHPISYFSKTTSADEAKLHSYELETL AVIYALKRFHTYVHGIPIKIVTDCNSLVETLKNRNSSAKIARWSLFLENYNYIIQHRPGLAMSHVDALSR LEHLAAFDDVDIDFQIRVAQARDPLIQTLKKELETTDVEGYQLQDGIVFKRSPSNRLKLYVPTEMVNNLI RSIHEQIGHLGAEKCCNQIDQNYWFPNRKTRIINFINNCLKCIIHSAPSRVNNRNLHSIQKEPYPFDTLH IDHFGPLPTSSLKKKYLLVVIDAFTKFVKLYPTTSTSTKEVCNALKQYFSYYSRPKRIISDRGTCFTSAA FSNFLSSRGISHVLNATGSPQANGQVERVNRIIRPILSKLSNQTDHVDWVTHLLSTEYALNNTIHSSTRF SPSMLLFGVNQRGPSVDILTEYLEDKNKAFSDLETIRAEASFNILKSQQNNEKQHAKHHRPAPVFNEGEF VVIKNVDNTPNSNKKLIARYKGPYVIHKRLPNDRYVIRDIDGIQMTQIPYDGVLESDKLRRWIVPLGGA
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute