Repbase Reports

2003, Volume 3, Issue 4
April 30, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 77

GYPSY4-I_AG

GYPSY4-I_AG is an internal portion of the GYPSY4_AG LTR retrotransposon - a consensus sequence.

Submitted:
30-Apr-2003
Accepted:
30-Apr-2003
Key Words:
LTR retrotransposon; Gyspy clade; 4-bp TSD; gag; AP protease; reverse transcriptase; integrase; GYPSY4_AG; GYPSY4-LTR_AG; GYPSY4-I_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Pavlicek,A., Kapitonov,V.V. and Jurka,J.
Title:
GYPSY4_AG, a family of LTR retrotransposons from African malaria mosquito.
Journal:
Repbase Reports 3:(4) p. 77 (2003)
Abstract:
GYPSY4_AG is a family of autonomous gypsy-like LTR retrotransposons. GYPSY4-I_AG, an internal portion of GYPSY4_AG, is flanked by GYPSY4-LTR_AG LTRs. The GYPSY4-I_AG consensus sequence was reconstructed based on multiple alignment of 5 copies; they are less than 2% divergent from the consensus sequence. The A. gambiae genome contains about 10 copies of GYPSY4_AG. The consensus sequence encodes the 1423-aa GYPSY4_AGp protein (pos. 119-4387), composed of gag (zinc-finger, 264-379), protease (417-502), reverse transcriptase (pos. 628-797) and integrase (pos. 1145-1290) domains. GYPSY4_AGp: PACIRVYLCTCVYDTTPFSIMLRKKELRRALIVDVPDTATVTQLRQLYASHEPVARSPRAAPPTTSATTP APACANHQDAAILCLPHYNGDDDFAHHENVANAAASTNNTTDAVSALPSAHGVAAALPRGPDDIEAQFEK LRQQQQLAELRQKVHQLETQQPAALCVKDFEAFIEPLDADKNPNVIRWFRDLERLFALYRVRDADKFFFT LRLLTGTAANVAKELVVTTYDELKKELIDNLHVVATPESVYRQLRNRRLRPQESALHYLFDMQRIAGQAS IADSELIPIVIDGLGSPSITSSLHFMPLTMDDFRKKLKLFESCRHLCTTQPPSADARATTNSRMERPRPS QEPIRCFNCSRFGHLQNACPRPKRPPGGCFRCFQTGHVYRNCPERRANATVEGNTSSDEALATNQEVSLT FFHPSAKRTTLPCVRSLLDTGSPVSFISDTIVPVKMLGPLSATEYCTMIKGPLYSRGKIDCTIRFKNHSV RHSFIILPGIAWPVIIGRDLLNSLNIFLTYSSLTTSCITKPLSTELKEVDTILPEKLDDAIRSICALDVA EADNELDLGKTLSLEQRSIVNSIVENSYLNYTSDVIPLKHPMKINLTHDTPIFTKPRRLSYGERQQVKQI VDKLLAENIIRPSNSPYASALVLVRKKSGEVRMCVDYRPLNKITVRDNYPLPLIETCLEHLCGKKFFSLL DLKSGFHQVPMSEESIPYTSFVTPDGQFEYLKMPFGLRNAPSEFQRFINSILREFIDDGRIVVYLDDIII ASTDLSSHFSTLRSVLEKIKQNNLELRLDKCKFVHEEIEYLGYKANFSGIQPSDRHIKALTNYPMPTNLK QLRRCLGLFSYFRRFVPSFSCIAKPMTNFFRRTKYLTSIQIACMLLKPYVTNLCILLSFPYSTQNGKPNY TVTQVPLVLALFSFRNRMTISCTLLLTFPKPLQKTSPSYTVMSLKLFPSFTLLSASTLMFMGSPLVTDCN SLVETLKNRNASAKIARWSLFLENYDYTICHRSGTSMPHVDALSRTEAVGAIGEIDLDFQLQVAQTRDPS IEALKHRLESEEVDGFLLQDGLVYRDIPDGQPQLYVPSEMVDNVIRHTHERIGHLGINKTFSKISQHYWF PHMKPTIDKFIKNCLKCIVYSAPHHTNARNMYSIPKEPLPFDTIHIDHLGPLPSSSLRKKYILVVIDAFT KLTKLYPTSSTNAKEVCSALSQYMSYYSRPRRIVSDRATCFTSTLFEDFLESHNISHVLNATGSPQANGQ VERVNRVLRPILSKLSDAPDQTDWVSKLRSAEYALNNTVHTSTNFCPSVLLFGVEQRGKVPDELAEYLDE KFDRASRDLEAIRAKALENIEESQRKNEEYFSKKHKPPQCYKEGDLVAIRYSDTTDSGNKKLNPKFRGPY VIHKVLPHDRYVVRDVEGCQLTQLPYDGVLEANKLRRWTESSD
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute