Repbase Reports

2003, Volume 3, Issue 4
April 30, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 71

BEL6-I_AG

BEL6-I_AG is an internal portion of the BEL6_AG LTR retrotransposon - a consensus sequence.

Submitted:
30-Apr-2003
Accepted:
30-Apr-2003
Key Words:
LTR retrotransposon; Bel clade; 5-bp TSD; peptidase; reverse transcriptase; RNase H; integrase; BEL6_AG; BEL6-LTR_AG; BEL6-I_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Kapitonov,V.V., Pavlicek,A. and Jurka,J.
Title:
BEL6_AG, a family of Bel/Pao-like LTR retrotransposons from African malaria mosquito.
Journal:
Repbase Reports 3:(4) p. 71 (2003)
Abstract:
BEL6_AG is a young family of Bel/Pao-like LTR retrotransposons. BEL6-I_AG, an internal portion of BEL1_AG is flanked by BEL6-LTR_AG LTRs. The BEL6-I_AG consensus sequence was reconstructed based on multiple alignment of 13 copies; they are ~0.3% divergent from the consensus sequence. Some copies can be active. The consensus sequence encodes one 1733-aa BEL6_AGp Bel-like protein (pos. 65-5263). BEL6_AGp is composed of the peptidase (pos. 150-275), reverse transcriptase, RNase H (pos. 1090-1180) and integrase (pos. 1450-1600) domains. BEL6_AGp: MTRTPRTSRTPTVKPAPQPGWVDVIVAVRPHVHMRDLAYGELIRIRDNIVQAKEEGKALTAVQCKVFGKK ADSALEEHNKHYGEIIKHDESEVHDAKFKETVKLHEEVMMEIESASEALAAQSISPKALIPAPSVSSVIV NAPLPRPIPSFSGKYEEWARFKTIFKDIVDKSSEDSRIKLYHLEKALSGEAAKVIDEKTINDGNYERAWQ LLSERYDNKRRMVDLHISGLLNLKKVNEESYVGLRGLVESVESHVENLKYLGENFTGLSCAMVIHLIANA LDIETKKLWEASVPRNELPCYEKTLCFLKERVSVLERCQGNVAAGQRGRFVSKGPSSSGVTPMRSNAATT VCSVVVCELCKGAHETFKCSELMRLHGKDRESFIRSKRLCLICLKPGHWRNRCKSHLNCNRCHGPHNTVL HWDNGPEPVSREPEQVSASQHVNNTDAAGSIVLLQTVLLYAELPNKEVLLCRAMLDSGSQISCVTEALAT KLGVNLVNVNVPVKGIGNIESSVKKKCTFTVKSRCSDFAMDVTCFVYREITGRIPSVYFDTSKWNLPDKS MLADPYFNNPSCVDILLGMDCLSEIMESGSVKLAKTLPMMTDTHFGWVIGGRVAEIHKEREVYTNVVTKE NLETIVQRFWEVEDVTSERSVKVEDEICEEHFVKTHYRESSGRYVVQLPLRESISQLCCSRSVALRRFYL LETKLLKNPSLREQYQAFMSEYEELGHCRVVDESEDDGSVKRWYLPHHAVLNPAKNTTKCRVVFDASAKV NGLSLNDVMMTGPKVQHDLLSIKLRFRMPRYVVSADISKMFRQIKVDPCDSPLQRVFWRASPNEQLRVLE LTTVTYGTAAAPFLATRTLLQLARDEREGFPLASRIIEENFYVDDGLFGANDIETVHAAQVQLIEVFRKA GMTLHKWSANDERLLESIPFEDRDALTKIGDCEANEIIKTLGLMWNPMNDEFIFLTKVPSKGRTPTKREV LSAIAKIFDPLGLISPVVVLAKILMQKLWLAKLDWDDQISEPLIEEWDNFLEALPTENQVRIPRHVVSTN AVSLEIHGFADASLKAYGACVYIRSIERNGEAQLRLVISKSRVAPLSNVTIPRMELLAASLLCRLVKKVL EALKDFNFETINLWSDSQIVLAWLKKPIECLNVFVRNRVAEINENRAFIWRYVRTHQNPADVISRGQSAS LLVSNEMWWNGPEFLRTCEIPNVCIDELNDDEIPELRNEVICNVIVPLKVLPILEKYESFRKTQRILAYI VRFKQNTKRRKGERINDPNPTIPELRESMRWIIRAIQHQDLPEVVSAVKNSKPLQRYQDLNLFLDGELLR VGGRIRHANLAFGNKHQLLLPNRNVITHRLIATIHRENLHVGPSGVIAILRQQFWVVNARSTVRMVLHKC ITCFRSKPTTLEQQMGDLPSYRVTAAPTFQRVGLDFAGPIMLKSGIRRVAAIKGYICVFVCMVTKAIHLE AVEDLSTGAFLSALRRFVSRRGIPEEIFSDNATNFVGAKNELRELYEMFRKEATGQGIFQFCQEKEIVWK MIPPGAPHFGGIWEAGVKSVKSVLKKIYKSASLTITDFSTLLCQIEAILNSRPLYAHSNDPNDLECLTPA HFTIDRPLIGVAEPSYLDMPEGRLNKWQRIQQLRQQFWNRWQREYLCELQTRYKWTKIRDNVKEGALVLI KEDNTPPQLWKLGRIARVFPGEDGLIRVVDVKTRSGEFKRPVHKLALLPVIDP
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute