Repbase Reports

2003, Volume 3, Issue 4
April 30, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 69

BEL5-I_AG

BEL5-I_AG is an internal portion of the BEL5_AG LTR retrotransposon - a consensus sequence.

Submitted:
30-Apr-2003
Accepted:
30-Apr-2003
Key Words:
LTR retrotransposon; Bel clade; 5-bp TSD; peptidase; RING Zn-finger; reverse transcriptase; integrase; BEL5_AG; BEL5-LTR_AG; BEL5-I_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Kapitonov,V.V., Pavlicek,A., Drazkiewicz,A. and Jurka,J.
Title:
BEL5_AG, a family of Bel/Pao-like LTR retrotransposons from African malaria mosquito.
Journal:
Repbase Reports 3:(4) p. 69 (2003)
Abstract:
BEL5_AG is an young family of Bel/Pao-like LTR retrotransposons. BEL5-I_AG, an internal portion of BEL1_AG is flanked by BEL5-LTR_AG LTRs. The BEL5-I_AG consensus sequence was reconstructed based on multiple alignment of 20 copies; they are ~1% divergent from the consensus sequence. The consensus sequence encodes one 1723-aa BEL5_AGp Bel-like protein (pos. 93-5261). BEL5_AGp is composed of the peptidase (pos. 118-200), RING Zn-finger (pos. 300-375), reverse transcriptase, and integrase (pos. 1414-1600) domains. BEL5_AGp: MAEARKVKSLRIQQTATQLSIQAIHTFSKSYNKETQRAEAIIRKQNLQKQYAKFIDLQDE LLPLDEGNEAENLALRQTVESAYYDAEANLASAVEANDKKPCVPASNIKLPDVKLPVFDG KPQNWSSFHSIFVAMIDSAELYSGVQKLYYLRTSLSGPALQLIQSVPISEENYSVAWNLL LNHYNHPKRLKQLHVEALFEDAALKKECANELRKLIENFEANVNALTQLGEPTAQWDTLL IQMLSRQLDPSTLRSWKEHSAEKKIDSYSDLVAFLYRRVGVLEVLPSTSSGKPPKQRVFA TTTMPNNNTKGCACCNRDHPVYTCDEFKKLSLNAKQKVITQHKLCYNCLRPGHHLRDCKS ASTCKSCHKRHHTQLCSLPQPSPTVPSSEEDQRDPPTTLASTSVVESITCASAGQHKTVL LATATVIIVDDEGHKHNARVLLDSGSESCFITENLAQQMKSTRERSNLCISGISSTNTTA KQSIRATLRSRVGRYFANLQFFILPRVTGNLPSSSIDTTGWNLPDNIFLADPHFDCIGRI DVLIGAEVFFDIMRPAGRILLGKDQPVLVNSELGWIVSGPAVSTLTPTSQASSITVNHAS TTVQDVHKLMERFWAIEEGEIVNAQSNEHAACEEHFRRTVSRNSSGRYVVRLPLKEHLLT KLVDNRKAAVRRFHFLQSRLSSNNEFRNSYSSFIDEYAELGHMKRISEEEYNNTNQHHYY LPHHAVTRQESLTTKLRVVFDASSKTSSGISLNDVLMVGPTIQDDIRSIIMRARKHSIMI VADIKMMYRQVLVDARDTSLQLIVWKPTPSESLQTYKLCTVTYGTASAPYLATRVLSQLA DDEGSSYPIAAKVLKKDFYVDDLLTGTSTAAEASEVITQLTALVSKGGFTLRKWATNDEQ VRQTISKDKLSEDESFCFDRDQIIKTLGLHWHPLNDSMTYRIKPFEEKLITKRSTLSGIA RLFDPIGLIGPVVTKAKIFMQSLWTLKASDGSIWNWDTELPEQLQKQWLSFKNELNLLNT IQIQRCVLLNEATSVQLHIFADASQTAYGACAYLRSTNKAGQIKTSLVASRSRVAPLKSQ SIPRLELCSALVASELYKSIQQAMQLDADIYFWLDSTVALYWIQASPSKWNTFVGNRVSK IQQATSSCTWSHINGQENPADHISRGLTASELVNCDLWWNGPPWLQLDQEQWPKPQLSSQ LPSEVSIEGRSITTTAAATKSPPCDAILLVNELLSKFSDYHKLLRVIAYCFRMRTKRDSS QETVVISTDELWNAEIRILQVVQRDIFEKEWTQLRQNSPVSNKSRLKWFHPFLCDDNLIR IGGRLSKSNQPFESKHQILLSAGHPLAEMLIRHLHKKHHHAAPQLLITILRQKYWVIGAR SLAKRICHECVPCCRARPRLLEQFMAELPTSRITPSRPFSIVGVDYWGPIGLSPIHRRAS SGKAFVAVFICFATKAVHLELVANLTTAKFIQAFRRFVARRGLCSDIHSDNGRNFLGASR ELRALVTSKQHRIEIIQECTSQGMRWHFNPPKASHFGGLWESAIHSAQKHFFRVLGKTTL PQDDMETLLCQIECCLNSRPLVPLSDDPSDLEPLTPGHFLVGSNLKAVPDNKLEDIPSNR LKHYQLVQKLLQQIWTRWSAEYLATLQPRSKWLKPPVKIDVGQLVLVKDESTTPLHWPLG RIIKTHPGDDGVARVVTLKTASGEYTRPIAKLCLLPVTSMVQN
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute