Repbase Reports

2003, Volume 3, Issue 4
April 30, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 68

BEL4-I_AG

BEL4-I_AG is an internal portion of the BEL4_AG LTR retrotransposon - a consensus sequence.

Submitted:
30-Apr-2003
Accepted:
30-Apr-2003
Key Words:
LTR retrotransposon; Bel clade; 5-bp TSD; peptidase; reverse transcriptase; integrase; BEL4_AG; BEL4-LTR_AG; BEL4-I_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Kapitonov,V.V., Pavlicek,A., Drazkiewicz,A. and Jurka,J.
Title:
BEL4_AG, a family of Bel/Pao-like LTR retrotransposons from African malaria mosquito.
Journal:
Repbase Reports 3:(4) p. 68 (2003)
Abstract:
BEL4_AG is a family of Bel/Pao-like LTR retrotransposons. BEL4-I_AG, an internal portion of BEL1_AG, is flanked by BEL4-LTR_AG LTRs. The BEL4-I_AG consensus sequence was reconstructed based on multiple alignment of 10 copies; they are less than 1% divergent from the consensus sequence. The consensus sequence encodes one 1761-aa BEL4_AGp Bel-like protein (pos. 95-5377). BEL4_AGp is composed of the peptidase (pos. 158-300), reverse transcriptase (pos. 800-930), and integrase (pos. 1480-1625) domains. BEL4_AGp: MPVDHSPVKEVVPAANNMEESQSSTVREFGSVPDVTKLDRQRTHLEWQLDRLEQMFVKHSTDVHSLKTIA DRVKVLALDYKQWYDSILDVVSDDQAQEAIERYGVFDDKVFELSKNIEYQLASQIPLPTTPNPFFGSEQK PTTVPVRARLPEIVLPHFDGNIRDWPAFRDAFQSLIHSSEQLTECDKLHYLAASLTKDARAVIDALEITS KNYDVAWKLLSERYENKYLIVKTTVEALFNISPLKRECADSLSRLVDDFERNLRMLEKEGEKPDAWSTLL VFRLSSLLDPTTLRHWELHRKSTTIPTYKDLVQFVRNHCHVLKSFSKPASGARTGDTMRSNPRVQTIHAA TSAVHSVAYNEKCKLCGVSKHSVFRCELMNNMSVADRKQLVQSKGLCFNCLSPAHRLRQCTSSGCKICQQ RHHTLLHEAAPATEASDAPSTSSTCPPQSLTHCSIQIENSVVLLQTVLVQVEDNHGRCHLARALLDSGAQ LNIVTERLTQRLGVAKRRENHRIGGIGEVSVTSQHSAVLKIHSLDSEYTASGKFHVLSKLTRELPSSRIN TSSWQIPRQVQLADPSFHSPGPIDLIIGAELYYDVVKEGLIKLSHERVTLQNTAFGWVIAGRVNVHAPPP PSSIVGHVCSTSIEEQLSKFWELESCRATSTLSVEESNCEKQFATTTTRDTDGRFIVQLPKREEKLALLG DSKGIATRRFLALERRLSSNASLKTAYTQFIEEYAELQHMTEVAESDATTSSPSYYLPHHCIVRPDSTTT KLRVVFDASCASDTGTSLNDALMIGPTIQDDLMSILLRFRMSKFALVADIEKMYRQINIAAIDRPLQRIL WRNSPTEPIRTFQLNTVTYGTSCAPYLATKTLQVLSQVGASTHPEAATILGRDFYMDDMLTGVNSIPEGQ RVCQQLIDLLASGGFCLRKWATNNRQIFEHLPQHLQDERTILNLDAKSPIIKTLGLKWNVSTDAFVFNIP RWNADNIITKRNALSDVAKLFDPIGLVGPVIIQAKLFLQELWRCQIAWDEPLTPALQNRWLLFREKLAML QTIHIPRWLLTDQRATNLQMHCFCDASEKAYGAAIYLRSTNTDGRVTTNLITAKSKVAPLADSRKQKRVC LPRLELSAALLLAHSYEKVSDALKLQVETIFWSDSTIVLHWLSATPSRWKTFIANRVSEIQHITHGKEWR HVPGTDNPADIISRGMDADQLETSTLWWHGPDWLAQPSEEWPNTHQPRQEEFTTDELEERPICMAVQSVA PNELFSLRSTFTGLQRLVAWLRRFRHNTNPANHQQRRLDHHLSLEELAESTLCLVRLAQAESFPEDIKHL SKGDSVGNNSPLKLLAPFLQDGLLRVGGRLRHAPIPFDRKHPYILPANHPLTNQIATLYHRTYQHANPQL LIASMRERFWPLRAKNLARRIVHSCYKCYRCRPTPAQQLMGDLPAERVTPTSTFLHTGVDLCGPIHYRHT SRKAQLIKGYVAIFVCMAVKAVHIELVADLSTNAFLAALRRFIGRRGKPAIIECDNARNFLGASREIASL SKQFNHQWQTSVIKSCIDDGIQFKFIPPRSPNFGGLWEAAVKSFKTHFKPTVGNAILTSDELNTLLIQIE GCLNSRPLTPLSNDPSDLEVLTPGHFLIHRPIVSLAEPSLEKLPFNRLDRWQKVQEFVRRLWKRWSTDYL SGLQQRTKWTKQKDNVKLDTMVLLKEDGLPPSKWCLGRVTQIIKGADDNIRVVIVKTKDGDFKRSISKIC VLPTDEPSSSS
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute