Repbase Reports

2003, Volume 3, Issue 4
April 30, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 67

BEL18-I_AG

BEL18-I_AG is an internal portion of the BEL18_AG LTR retrotransposon - a consensus sequence.

Submitted:
30-Apr-2003
Accepted:
30-Apr-2003
Key Words:
LTR retrotransposon; Bel clade; 5-bp TSD; peptidase; reverse transcriptase; integrase; BEL18_AG; BEL18-LTR_AG; BEL18-I_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
BEL18_AG, a family of Bel/Pao-like LTR retrotransposons from African malaria mosquito.
Journal:
Repbase Reports 3:(4) p. 67 (2003)
Abstract:
BEL18_AG is a young family of Bel/Pao-like LTR retrotransposons. BEL18-I_AG, an internal portion of BEL18_AG is flanked by BEL18-LTR_AG LTRs. The BEL18-I_AG consensus sequence was reconstructed based on multiple alignment of 4 copies; they are ~1% divergent from the consensus sequence. The consensus sequence encodes one 1985-aa BEL18_AGp Bel-like protein (pos. 183-6138). BEL18_AGp is composed of the peptidase A16 (pos. 360-450), reverse transcriptase (pos. 970-1149) and integrase (pos. 1680-1830) domains. BEL18_AGp: MEHEHExKAPPAVAQTNESQQPETGALDHRPLAPAADSLHFRSFAPTGQDWTVNSSLEIVDRARSSTPNA PLGAGLLLRxPQQRLTSEVREAPASRYTPLANSTVADLGxLHRSSSETVPRLAHLPTTADVQQPAPSQGG VSAGTVPRAADGASGAAIEDMELxPQAQDGASAGTVLRTAVGASGAAISNVHQPTPSQTGTPGRTMADKL AESSEAVAALELRMRNLTRRKLELERRELEFEEQLILAESKRIGDGFISMIDDEGESNKMVDWSRRGDSE GHSSHHPNVSPSSSRTVPPGNAQQGNDSVVSQQRQPRSGEYLNIADGAVDTYPFRNSIGTTLMNVNQSQI LARKASCKELPYFSGKPEEWPIFIATYETSTAACGYSDEENTLRLQRALKGKALEAVQPCLLHASNLTSV IETLRMLYGRPEIIVHSLIHRIHQMPAPRIERLETVIDFGMAVRNMCATITASGLEEYKCNVALMHELVE KLPHALRLDWARHRMQSSSATLSEFGKWIETQVKAASLITLPSLEFRPERKLDHKSRTHHMNIHNATGLV SEGSQICLLCEATCVDLSQCEQFNRLNVNDRWATIRRLNACRKCLKIHTYGCKGKKACGKNGCEYLHHEL LHNPERHSKPNEYAVATASLNAHSEVTGDVFLKYIPVIVYGRDKAITTFAFFDSGSTGTFIEHSLIEELG LEGQPHPLCLKWTGNSERDETGSIRVSLLEISGVGQNSSVHIIPKVHTVQSLSLPAQTLAVTQLTKQYAH LQGLPIHAYENARPRLLIGIDNHHLVRPTRYAEGGKYEPVAAKTSLGWIVYGPRNKNSNSVNIQAIHTIH ICNCGADAEANLDAAVKNFFTLESLGIVKPLETLRSKDDERALGILNAESKFNGKHYESGLLWRFDDVKL PCSRDMAMRRYKCLQKRMSKDSVLAKAVIEKMRDYERQGYIRRLSPEELSMKGSRDWFLPIFPVFNANKP GKVRVVFDAAAKVQGVSLNTYLLNGPDLLAGLLSVLYKFREHRVAIVGDIKEMFFQVRMKPDDQRSQMIL WNENDFTGSEPDVYAVAVMTFGAACSPSTAQFIKNLNADRFADKYSRAVKCIKEEHYVDDLLASAETDEE IITLAEQVRHIHAEGGFEIRNWLSNSHRVTSHLQREASPEDKINMCSDDRTEKVLGMWWDTLTDTFTFKL SPKHDIQLLSGGRMPTKRDVLRTVMAIYDPMGIIANFLMYVKILMQEIWRAGLGWDDVLSGRLAEKWSVW VAVLPTISQVRVPRCYRQFTSVNAKIQLHVFCDASENGMAAVAFFRFNDGGIIECSLVGAKTRVAPIKFV SIPRLELQAAVIGARFAAAIIAQHRIAIERIFYWTDSRDVICWMRSDHRRFSQFVAFRVGELLETTSVHE WRWLSTKLNVADDGTKWQKVPTADPDSRWFRGPDFLWKPECEWPVPEQYPTDTKEELRLHMMHHNTNTKP WIQLERFSSWNRLLRSVVYVLRFVSFIVSKRTARTTGPLTQGELEKAEYAILRLAQRDAFSQEIRRLTDA RDASEQRCTWKSVLPKTSILAKLSPEVDDNGVLRMRGRLTNCPWVSESTKRPVILPRQHQVTALILADFH RRFQHINHHAAINAIRSKLYIPRLQAEFNRIRRTCQHCKNRDAKPEPPEMGNLPSERLAAYQKPFSFTGV DYFGPVTVAVGRRVEKRWGVLFTCLTTRGIHLEAAHSLTTSSCILAIRRFIARRGQPLEFISDNGTNFVG ASRELAEAWEAIDKQRLAEEFTTPRLAWKFIPPGGPHFGGCWERLVRSVKKAMSEIRMSRLPTDEVLTTA LTEIEAMLNSRPLTQVPLDSESELPLTPNHFLLGTANGEAPKAVFSDDIATLKTTWKVSEVMANLFWKKW VAYYLPTLTRRVKWHHQVRPIKEGDIVVIVDPNLPRNTWPKGRVVAVIQSKDGQVRRATVATSTGIYERP ATKIAVLDVQQENNTYPPETNSxQH
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute