Repbase Reports

2003, Volume 3, Issue 3
March 31, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 65

piggyBac1_AG

piggyBac1_AG is an autonomous DNA transposon - a consensus sequence.

Submitted:
31-Mar-2003
Accepted:
31-Mar-2003
Key Words:
Nonautonomous DNA transposon; piggyBac superfamily; piggyBacN1_AG; piggyBac1_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
piggyBac1_AG: a family of autonomous piggyBac-like DNA transposons from African malaria mosquito.
Journal:
Repbase Reports 3:(3) p. 65 (2003)
Abstract:
There are 5 copies of piggyBacN9_AG in the genome, they are ~98% identical to the consensus sequence. This family is characterized by the TTAA target site duplications, and by the 17-bp terminal inverted repeats (1 mismatch). The genome harbors several families of piggyBac-like elements. An ancestral form of piggyBac1_AG was directly related to the piggyBacN1_AG nonautonomous family. piggyBac1_AG encodes the 552-aa piggyBac1_AGp transposase (positions 1165-2820). piggyBac1_AGp: MLKKYNYQSIILSKLIVMTITQNLSNFQAQHITHDGTIWSSQPTIRRKILAHNILRSSQSGPTRKTEGLS IIKTFKLLMSDEMIDIIVRETNRKAQQIYEREQVTNSAKSASMHTWKTLTTSEFEAYLGILLLAGVMRSN YVHSTELWKTSSHPIFRATMSLQRFRSINRFIRFDDGRTREVRKEMDKSAAISDIFAMLNRNLQACYVAG SHVTVDEQLYPYRGGTGFTQYIPSKPAKYGIKVWWVCDAVTSYPIKGQIYTGLAPSGQRERHQGERVVKD LCRIFRGSGRSVICDIFFTSYNLASSLMSDFKLALLGTVNKRRTFVPPMFANPHGREIQSTLYGFSENIS ICSYIPKKNKSVVMLSTMHYDKDVQGPKEKPAMIIDYNKFKGGVDNMDKCLSEYSTKRKTNRWPLAFFFN ILDIAAFAAFKIYKENNLQNCQSTDYRRMFLQQLSEQLTMPEIQRRSENVQIMRHFGPRSGVESMLGGPL IALSKKNTTNDVEERDVSGRIKHKGNCYLCVKKRSTRKSCSTCKKPICTLHSVIKTSCKSCD
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute