Repbase Reports

2003, Volume 3, Issue 3
March 31, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 58

HAT1_AG

HAT1_AG is a hAT-like autonomous DNA transposon - a consensus sequence.

Submitted:
31-Mar-2003
Accepted:
31-Mar-2003
Key Words:
Autonomous DNA transposon; hAT superfamily; 8-bp TSD; transposase; HATN4_AG; HAT1_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Kapitonov,V.V., Pavlicek,A. and Jurka,J.
Title:
HAT1_AG: a family of autonomous hAT-like DNA transposons from African malaria mosquito.
Journal:
Repbase Reports 3:(3) p. 58 (2003)
Abstract:
HAT1_AG is a young family of autonomous DNA transposons that belongs to the hAT superfamily. HAT1_AG elements are less than 1% divergent from the consensus sequence. The genome harbors 6 HAT1_AG elements. HAT1_AG has imperfect 11-bp terminal inverted repeats (3 mismatches). HAT1_AG encodes the 603-aa HAT1_AGp transposase (pos. 1473 - 3284). The N-terminus of HAT1_AGp (pos. 10-50) is composed of the BED zinc finger. HAT1_AGp: MMAPTNATTSPVWDHFSPVETGAKCLYCLKVFKYTKGTTSNLKRHLNLVHKTVPYLKQKQ PIPQTINIDDEAGPSAVNFQPSNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC LPFNLVESEIFKKFVYTLNPNYIMPTRKSLSNALLPSVYNQEFEKAKEKLSTAKAIAITS DGWTNLNQISFFALTGHYIDENCKLSSILIECSEFENPHSGRNIANWIQGTLNKFDIEDK IVAMVTDNASNMKAASTELNFCHIPCFAHTLNLIVRDAIKKSVLPVVEEVKRVVMLFKKS PKASQMLADTQKKLNLDQLKMIQEVSTRWNSGYDMLNRFYKNKIALLSCADSLKMKISLE SHDWEAIEQIVRVLKYFYSATNIVSAQKYITISHVGLLCNVLLTKTSQFRNDEDIAENIQ NLVALLIEGLQNKLKIYRSNEQILKSMILDPRIKQLGFQDDVEKFKNICESIISELLPLQ KPAVEVEKVVKKVSKDVDMLFGDLLKNKGAQNYKTPRQIAENELHQYLSVENIDLENDPL LWWKEHQVLYPSLYTLAMSTLCIPGTSVPCERLFSKAGQIYSEKRSRLAPKKLQEILFIQ QNA
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute