Repbase Reports

2003, Volume 3, Issue 3
March 31, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 55

COPIA5-I_AG

COPIA5-I_AG is an internal portion of the COPIA5_AG LTR retrotransposon - a consensus sequence.

Submitted:
31-Mar-2003
Accepted:
31-Mar-2003
Key Words:
LTR retrotransposon; Copia clade; 5-bp TSD; reverse transcriptase; integrase; COPIA5_AG; COPIA5-LTR_AG; COPIA5-I_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Pavlicek,A., Kapitonov,V.V. and Jurka,J.
Title:
COPIA5_AG, a family of autonomous, copia-like LTR retrotransposons from African malaria mosquito.
Journal:
Repbase Reports 3:(3) p. 55 (2003)
Abstract:
COPIA5_AG is a young family of copia-like LTR retrotransposons. COPIA5-I_AG, an internal portion of COPIA5_AG is flanked by 100% identical COPIA5-LTR_AG LTRs. The consensus was reconstructed from 5, >99% identical, copies of COPIA5-AG internal sequence. The consensus sequence encodes the 1312-aa COPIA5_AGp protein (positions 76-4011). COPIA5_AGp: MALPSSSNSSSSFVGSTSIPSIERLLGRENWTSWKFAAKTFLQLEGLWEVVKPVKKEDGTFETVDEKKDL QARLKLILLLDPTIYVHIEDAESARSAWDKLEMAFEDKGLSRQIGLLHKLIKSDLDTCGSMNSYVNQVIS TANQLNAIGFKLPDLWVGMILLAGLPEEYRPMILAMENSGVAITGDYVKTKLLQERPLLRNENVQALATN KRREVFKPKQKPSSSKGPQCRKCGRYGHIAKFCKDDRKGGTTLCTVLSTFGNSEANEWILDSAAYAHMTS NKDLLSNLQNATGKVVAANGGTLDIVARGTAIIQPKCMEEIVTISDVKLIPGLTSNLLSVSRMVEKGYTV QFNTKGCKVYNPSGKLVLTGIHNNNQFKVEQVANNMQEALSCNTAESFELWHKRMGHLGAVNLKKLAGGL ATGITLKNMDGADCRVCPLGKHSKLPFPKKGSRAENVLDLVHSDINGPMETHSLGGHRYYITFIDDKTRR IFVYFLKTKSEVEVFEAFKRFHAMAERQSGRKLKTLRTDNGKEYMNKSLTSFLQKEGIRHETSNGYTPQQ NGLAERANRTIVEMARCLLFEGNMTKGFWAEAVSTAVYLINRSPTRGHNLTPEEAWNGRKPDLSHLRVFG TKAMVMIPKEKRRKWDPKSHECVLTGFDEETKGYRLYDHKKKQTIISREVIFLDEGCSSNVTVTAMQEPR RTFVRLDIEETTSIQPVQIPVPNFAPDAGSDSTLEENDAETDGELDESTTDDENNTSTETMVQSEDDSSD FLGFSGSDVDGFVAVASGMYSGTYADPVSHQEALARDDSKEWGTAMQEEYNALMENKTWTLTSLPKGRQA IKCKWVYRTKCDSSGNLTRYKARLVVKGFSQRKGEDYDETYAPVVRYCSLRYLFALAIKHDLMIDQMDAV TAFLQGDLDEDIYMEQPPCFVDGQRKTLVCKLNKAIYGLKQASRVWNNKLDAALQRFGLIPTQYDPCVYV GSEGGKIIIVAIYVDDMMIFSNDVAWKKQLKKHLCSCFRMKDLGAAQHCLGIRIQRTKETIKLDQEIYIE SILKRFNMDKCKPVAVPMNNSEKLTKEESPKSNNETAAMKDVPYQEAVGCLMYLAQSTRPDILYAVNMLS RFNKNPGQKHWNGVKHVMRYLRGTSNFKLVYKKNVDSKIIGYCDADWGSDPDERKSTTGNIFMAQGGAIS WMCKKQPTVALSTCEAEYMSVSAAVQEASWWRGLSAKLANADEVIEIRCDNQSCIAIAKNGGYHPRTKHI DIRHHFIKDALSRGIVTLEYVSTEDQIADGLTKPLQRTKFEISRELMGISEA
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute